CATH Domain: 2c0gA01 XML data for domain: 2c0gA01

Molscript image for 2c0gA01
2c0gA01
PDB coordinates for domain 2c0gA01

PDB 2c0g, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.30 Glutaredoxin
3.40.30.10 Glutaredoxin Gene3D
3.40.30.10.19
3.40.30.10.19.1
3.40.30.10.19.1.1
3.40.30.10.19.1.1.1
3.40.30.10.19.1.1.1.1

Segment boundaries for domain 2c0gA01

Chopping figure for domain 2c0gA01
DomainStart PDB ResidueStop PDB Residue
2c0gA01 1024 1145
2c0gA02 1146 1251

Structural Neighbourhood (22 entries)

There are 22 matching structural neighberhood comparisons for CATH ID 3.40.30.10.19.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 22 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2b5eA01 87.92 Protein disulfide isomerase activityProtein disulfide oxidoreductase activityProtein bindingProtein foldingEndoplasmic reticulum lumen 3.40.30.10 119 13 87 1.98 2.26
2dizA00 85.96 Anti-apoptosisHomo sapiensThioredoxin domain-containing protein 5 3.40.30.10 117 18 89 3.42 3.83
2pu9C00 85.38 Thioredoxin F-type, chloroplasticSpinacia oleraceaProtein binding 3.40.30.10 111 12 84 2.67 3.16
1thxA00 85.21 Nostoc sp. PCC 7120Thioredoxin-2 3.40.30.10 108 16 85 2.57 3.01
2e0qA00 85.18 Sulfolobus tokodaii140aa long hypothetical thioredoxinThioredoxin 1 3.40.30.10 104 15 82 2.34 2.83
1gh2A00 84.49 CytoplasmHomo sapiensThioredoxin-like protein 1Disulfide oxidoreductase activity 3.40.30.10 107 14 82 2.19 2.65
3gnjA00 84.24 Desulfitobacterium hafniense DCB-2Thioredoxin domain protein 3.40.30.10 107 19 84 2.53 3.00
2b5eA04 83.99 Endoplasmic reticulum lumenProtein disulfide oxidoreductase activityProtein disulfide isomerase activityProlyl 4-hydroxylase, beta polypeptide [EC:5.3.4.1]Saccharomyces cerevisiae 3.40.30.10 140 17 79 2.47 3.12
1a8yA02 83.62 Calsequestrin-1Oryctolagus cuniculus 3.40.30.10 102 12 80 2.44 3.04
1mekA00 83.49 Cell surfaceER-Golgi intermediate compartmentProtein disulfide isomerase activityProtein bindingPeptidyl-proline hydroxylation to 4-hydroxy-L-proline 3.40.30.10 120 12 89 2.61 2.92
1bjxA00 83.31 Cell surfaceProtein disulfide isomerase activityER-Golgi intermediate compartmentProtein bindingPeptidyl-proline hydroxylation to 4-hydroxy-L-proline 3.40.30.10 110 18 83 3.78 4.52
1w4vA00 82.82 Thioredoxin, mitochondrialHomo sapiensThioredoxin 1 3.40.30.10 110 18 86 2.76 3.18
1a8yA01 82.32 Calsequestrin-1Oryctolagus cuniculus 3.40.30.10 124 9 87 3.33 3.79
1g7eA00 81.84 Rattus norvegicusEndoplasmic reticulum lumenEndoplasmic reticulum protein 29Transport vesicleEndoplasmic reticulum resident protein 29 3.40.30.10 122 28 97 3.45 3.54
1sjiA03 80.95 Canis lupus familiarisCalsequestrin-2 3.40.30.10 123 16 91 3.33 3.66
1v98A00 80.84 Thermus thermophilus HB8Thioredoxin 2 [EC:1.8.1.8]Thioredoxin 3.40.30.10 92 16 72 3.05 4.18
2trcP01 79.40 PhosducinRattus norvegicus 3.40.30.10 131 11 80 3.49 4.31
2f51A00 79.22 Trichomonas vaginalisThioredoxin 1Thioredoxin 3.40.30.10 101 18 77 3.24 4.16
2kucA00 77.59 Bacteroides thetaiotaomicronPutative disulphide-isomerase 3.40.30.10 121 12 93 4.35 4.66
2in3A01 75.56 Nitrosomonas europaeaPutative protein-disulfide isomerasePutative uncharacterized protein 3.40.30.10 78 6 60 2.86 4.72
2qsiA01 75.50 Putative hydrogenase expression/formation protein hupGHydrogenase-1 operon protein HyaERhodopseudomonas palustris 3.40.30.10 82 15 65 2.92 4.45
1ttzA00 75.15 Xanthomonas campestris pv. campestrisPutative uncharacterized protein 3.40.30.10 74 16 59 2.81 4.76
Displaying entries 1 to 22 (page 1 of 1)


Domain ATOM Sequence

>pdb|2c0gA01
CTGCVDLDELSFEKTVERFPYSVVKFDIASPYGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDK
NFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTPLYIG    

Domain COMBS Sequence

>pdb|2c0gA01
MRGSHHHHHHGSVTCTGCVDLDELSFEKTVERFPYSVVKFDIASPYGEKHEAFTAFSKSAHKATKDLLIATVGVKDYGEL
ENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPSHVDVTLDNLKAFVSANTPLYIG    

Domain History Events (14)

Domain assigned by auto on 02 Nov 2006 06:21

Assigning to "3.40.30.10" based on similarity with "2c0gB01"

Flow stage update by auto on 02 Nov 2006 06:12

No in_process hits for Domain "2c0gA01" ready to be processed

Update comment by auto on 02 Nov 2006 03:17

Domain "2c0gA01" hits Domain "2c0gB01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 21:56

Domain "2c0gA01" hits Domain "2c0eA01" (98.4251968503937% over 93.3823529411765%) which is currently in process

Update comment by auto on 01 Nov 2006 18:04

Domain "2c0gA01" hits Domain "2c0fA01" (99.2647058823529% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 14:28

Domain "2c0gA01" hits Domain "2c0fB01" (99.2647058823529% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "2c0gA01" hits Domain "2c0fB01" (99.2647058823529% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:50

Domain "2c0gA01" hits Domain "2c0fB01" (99.2647058823529% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:09

Domain "2c0gA01" hits Domain "2c0fB01" (99.2647058823529% over 100%) which is currently in process

Flow stage update by auto on 19 Oct 2006 01:41

Domain "2c0gA01" hits Domain "2c0fB01" (99.2647058823529% over 100%) which is currently in process

Flow stage update by auto on 19 Oct 2006 01:40

NW result present for Domain "2c0gA01"

Flow stage update by auto on 16 Oct 2006 16:34

All required files are present for Domain "2c0gA01"

Flow stage update by auto on 16 Oct 2006 09:41

Beginning processing for Domain "2c0gA01"

Insertion by auto on 16 Oct 2006 09:24

Final ChopClose added based on similarity with "1ovnA"