CATH Domain: 2bw8A00 XML data for domain: 2bw8A00

Molscript image for 2bw8A00
2bw8A00
PDB coordinates for domain 2bw8A00

PDB 2bw8, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.120 Jelly Rolls
2.60.120.180 Gene3D
2.60.120.180.4
2.60.120.180.4.1
2.60.120.180.4.1.1
2.60.120.180.4.1.1.1
2.60.120.180.4.1.1.1.1

[top]
Segment boundaries for domain 2bw8A00

Chopping figure for domain 2bw8A00
DomainStart PDB ResidueStop PDB Residue
2bw8A00 2 227

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.60.120.180.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2vg9A00 82.73 Neocallimastix patriciarumBifunctional endo-1,4-beta-xylanase A 2.60.120.180 217 11 87 2.86 3.26
1t6gC00 78.86 Aspergillus nigerEndo-1,4-beta-xylanase A 2.60.120.180 182 12 73 2.61 3.53
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2bw8A00
TVELCGRWDARDVAGGRYRVINNVWGAETAQCIEVGLETGNFTITRADHDNGNNVAAYPAIYFGCHWGACTSNSGLPRRV
QELSDVRTSWTLTPITTGRWNAAYDIWFSPVTNSGNGYSGGAELMIWLNWNGGVMPGGSRVATVELAGATWEVWYADWDW
NYIAYRRTTPTTSVSELDLKAFIDDAVARGYIRPEWYLHAVETGFELWEGGAGLRSADFSVTVQKL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2bw8A00
MTVELCGRWDARDVAGGRYRVINNVWGAETAQCIEVGLETGNFTITRADHDNGNNVAAYPAIYFGCHWGACTSNSGLPRR
VQELSDVRTSWTLTPITTGRWNAAYDIWFSPVTNSGNGYSGGAELMIWLNWNGGVMPGGSRVATVELAGATWEVWYADWD
WNYIAYRRTTPTTSVSELDLKAFIDDAVARGYIRPEWYLHAVETGFELWEGGAGLRSADFSVTVQKL
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 01 Nov 2006 18:22

Assigning to "2.60.120.180" based on similarity with "2bw8B00"

Flow stage update by auto on 01 Nov 2006 18:04

No in_process hits for Domain "2bw8A00" ready to be processed

Update comment by auto on 01 Nov 2006 14:28

Domain "2bw8A00" hits Domain "2bw8B00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "2bw8A00" hits Domain "2bw8B00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:50

Domain "2bw8A00" hits Domain "2bw8B00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:09

Domain "2bw8A00" hits Domain "2bw8B00" (100% over 100%) which is currently in process

Flow stage update by auto on 19 Oct 2006 01:41

Domain "2bw8A00" hits Domain "2bw8B00" (100% over 100%) which is currently in process

Flow stage update by auto on 19 Oct 2006 01:40

NW result present for Domain "2bw8A00"

Flow stage update by auto on 16 Oct 2006 16:34

All required files are present for Domain "2bw8A00"

Flow stage update by auto on 16 Oct 2006 03:13

Beginning processing for Domain "2bw8A00"

Insertion by auto on 15 Oct 2006 23:07

Final ChopClose added based on similarity with "1h0bA"