Domain assigned by auto on 28 Apr 2006 21:30
Assigning to "2.60.40.420" based on similarity with "1niaA01" (NWSI: 100, NWO: 100, SPS: 97.47, SPO: 99, RMSD: 0.36)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2bw4A01 | 7 | 158 |
| 2bw4A02 | 159 | 325 |
There are 10 matching structural neighberhood comparisons for CATH ID 2.60.40.420.1.1.1.1.1 (SIMAX score < 5)
>pdb|2bw4A01 VDISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLI NPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLP
Assigning to "2.60.40.420" based on similarity with "1niaA01" (NWSI: 100, NWO: 100, SPS: 97.47, SPO: 99, RMSD: 0.36)
NW result present for Domain "2bw4A01"
All required files are present for Domain "2bw4A01"
Beginning processing for Domain "2bw4A01"