Domain assigned by auto on 08 Aug 2007 14:28
Assigning to "2.40.10.10" based on similarity with "1h8dH01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2bvrH01 | 16 | 27 |
| 2bvrH01 | 121 | 232 |
| 2bvrH02 | 28 | 120 |
| 2bvrH02 | 233 | 243 |
There are 15 matching structural neighberhood comparisons for CATH ID 2.40.10.10.38.1.1.1.1 (SIMAX score < 5)
>pdb|2bvrH01 IVEGSDAEIGMSVCLPDRETAASLLQAGYKGRVTGWGNLKEKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKP DEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVF
Assigning to "2.40.10.10" based on similarity with "1h8dH01"
No in_process hits for Domain "2bvrH01" ready to be processed
NW result present for Domain "2bvrH01"
All required files are present for Domain "2bvrH01"
Beginning processing for Domain "2bvrH01"
Final ChopClose added based on similarity with "1hxeH"