CATH Domain: 2bs9A01 XML data for domain: 2bs9A01

Molscript image for 2bs9A01
2bs9A01
PDB coordinates for domain 2bs9A01

PDB 2bs9, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.40 Immunoglobulin-like
2.60.40.1500 Glycosyl hydrolase domain; family 39 Gene3D
2.60.40.1500.1
2.60.40.1500.1.1
2.60.40.1500.1.1.1
2.60.40.1500.1.1.1.1
2.60.40.1500.1.1.1.1.1

[top]
Segment boundaries for domain 2bs9A01

Chopping figure for domain 2bs9A01
DomainStart PDB ResidueStop PDB Residue
2bs9A01 2 14
2bs9A01 360 482
2bs9A02 15 359

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2bs9A01
GVVNVPSNGREKFDELLYRDGEMIVTRRKDGSIAAVLWNLVMEKGEGLTKEVQLVIPVSESAVFIKRQIVNEQYGNAWRV
WKQMGRPRFPSRQAVETLRQVAQPHVMTEQRRATDGVIHLSIVLSKNEVTLIEIEQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2bs9A01
MGVVNVPSNGREKFDELLYRDGEMIVTRRKDGSIAAVLWNLVMEKGEGLTKEVQLVIPVSESAVFIKRQIVNEQYGNAWR
VWKQMGRPRFPSRQAVETLRQVAQPHVMTEQRRATDGVIHLSIVLSKNEVTLIEIEQ
BLAST against CATH

[top]
Domain History Events (22)

Domain assigned by auto on 20 Dec 2006 19:33

Assigning to "2.60.40.1500" based on similarity with "2bfgA01"

Flow stage update by auto on 20 Dec 2006 19:32

No in_process hits for Domain "2bs9A01" ready to be processed

Update comment by auto on 20 Dec 2006 15:38

Domain "2bs9A01" hits Domain "2bs9H01" (100% over 100%) which is currently in process

Update comment by auto on 20 Dec 2006 11:35

Domain "2bs9A01" hits Domain "2bs9E01" (100% over 100%) which is currently in process

Update comment by auto on 20 Dec 2006 07:38

Domain "2bs9A01" hits Domain "2bs9F01" (100% over 100%) which is currently in process

Update comment by auto on 20 Dec 2006 03:38

Domain "2bs9A01" hits Domain "2bs9B01" (100% over 100%) which is currently in process

Update comment by auto on 19 Dec 2006 23:35

Domain "2bs9A01" hits Domain "2bs9C01" (100% over 100%) which is currently in process

Update comment by auto on 19 Dec 2006 19:41

Domain "2bs9A01" hits Domain "2bs9D01" (100% over 100%) which is currently in process

Update comment by auto on 19 Dec 2006 15:30

Domain "2bs9A01" hits Domain "2bfgG01" (100% over 100%) which is currently in process

Update comment by auto on 19 Dec 2006 11:27

Domain "2bs9A01" hits Domain "2bfgE01" (100% over 100%) which is currently in process

Update comment by auto on 19 Dec 2006 07:31

Domain "2bs9A01" hits Domain "2bfgD01" (100% over 100%) which is currently in process

Update comment by auto on 19 Dec 2006 03:32

Domain "2bs9A01" hits Domain "2bfgC01" (100% over 100%) which is currently in process

Update comment by auto on 18 Dec 2006 23:30

Domain "2bs9A01" hits Domain "2bfgA01" (100% over 100%) which is currently in process

Update comment by auto on 18 Dec 2006 19:31

Domain "2bs9A01" hits Domain "2bfgH01" (100% over 100%) which is currently in process

Update comment by auto on 18 Dec 2006 15:31

Domain "2bs9A01" hits Domain "2bfgB01" (100% over 100%) which is currently in process

Update comment by auto on 18 Dec 2006 11:32

Domain "2bs9A01" hits Domain "1w91G01" (97.8102189781022% over 100%) which is currently in process

Update comment by auto on 18 Dec 2006 07:32

Domain "2bs9A01" hits Domain "2bfgF01" (100% over 100%) which is currently in process

Flow stage update by auto on 18 Dec 2006 07:31

Domain "2bs9A01" hits Domain "2bfgF01" (100% over 100%) which is currently in process

Flow stage update by auto on 18 Dec 2006 07:31

NW result present for Domain "2bs9A01"

Flow stage update by auto on 17 Dec 2006 15:26

All required files are present for Domain "2bs9A01"

Flow stage update by auto on 17 Dec 2006 07:29

Beginning processing for Domain "2bs9A01"

Insertion by auto on 17 Dec 2006 07:22

Final ChopClose added based on similarity with "2bs9B"