CATH Domain: 2bs2A02 XML data for domain: 2bs2A02

Molscript image for 2bs2A02
2bs2A02
PDB coordinates for domain 2bs2A02

PDB 2bs2, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.700 Flavocytochrome C3; Chain A, domain 1
3.90.700.10 Flavocytochrome C3; Chain A, domain 1 Gene3D
3.90.700.10.3
3.90.700.10.3.1
3.90.700.10.3.1.1
3.90.700.10.3.1.1.1
3.90.700.10.3.1.1.1.1

[top]
Segment boundaries for domain 2bs2A02

Chopping figure for domain 2bs2A02
DomainStart PDB ResidueStop PDB Residue
2bs2A01 1 258
2bs2A01 366 436
2bs2A02 259 365
2bs2A03 437 554
2bs2A04 555 648

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.90.700.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1chuA02 90.93 Nicotinate and nicotinamide metabolismMetabolic pathwaysAlanine, aspartate and glutamate metabolismL-aspartate oxidase [EC:1.4.3.16]L-aspartate oxidase activity 3.90.700.10 104 33 92 1.38 1.49
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2bs2A02
TPLFPSGILLTEGCRGDGGILRDVDGHRFMPDYEPEKKELASRDVVSRRMIEHIRKGKGVQSPYGQHLWLDISILGRKHI
ETNLRDVQEICEYFAGIDPAEKWAPVL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2bs2A02
TPLFPSGILLTEGCRGDGGILRDVDGHRFMPDYEPEKKELASRDVVSRRMIEHIRKGKGVQSPYGQHLWLDISILGRKHI
ETNLRDVQEICEYFAGIDPAEKWAPVL
BLAST against CATH

[top]
Domain History Events (17)

Domain assigned by auto on 24 Nov 2007 03:51

Assigning to "3.90.700.10" based on similarity with "2bs3A02"

Flow stage update by auto on 24 Nov 2007 03:49

No in_process hits for Domain "2bs2A02" ready to be processed

Update comment by auto on 24 Nov 2007 03:45

Domain "2bs2A02" hits Domain "2bs3D02" (100% over 100%) which is currently in process

Update comment by auto on 24 Nov 2007 03:41

Domain "2bs2A02" hits Domain "2bs3A02" (100% over 100%) which is currently in process

Update comment by auto on 24 Nov 2007 03:37

Domain "2bs2A02" hits Domain "1e7pJ02" (100% over 100%) which is currently in process

Update comment by auto on 24 Nov 2007 03:32

Domain "2bs2A02" hits Domain "1e7pG02" (100% over 100%) which is currently in process

Update comment by auto on 24 Nov 2007 03:27

Domain "2bs2A02" hits Domain "1e7pD02" (100% over 100%) which is currently in process

Update comment by auto on 24 Nov 2007 03:16

Domain "2bs2A02" hits Domain "1e7pA02" (100% over 100%) which is currently in process

Update comment by auto on 24 Nov 2007 03:10

Domain "2bs2A02" hits Domain "1qlbD02" (100% over 100%) which is currently in process

Update comment by auto on 24 Nov 2007 03:03

Domain "2bs2A02" hits Domain "1qlaA02" (100% over 100%) which is currently in process

Update comment by auto on 24 Nov 2007 02:47

Domain "2bs2A02" hits Domain "1qlbA02" (100% over 100%) which is currently in process

Update comment by auto on 23 Nov 2007 14:10

Domain "2bs2A02" hits Domain "1qlaD02" (100% over 100%) which is currently in process

Flow stage update by auto on 23 Nov 2007 14:05

Domain "2bs2A02" hits Domain "1qlaD02" (100% over 100%) which is currently in process

Flow stage update by auto on 23 Nov 2007 14:03

NW result present for Domain "2bs2A02"

Flow stage update by auto on 23 Nov 2007 14:02

All required files are present for Domain "2bs2A02"

Flow stage update by auto on 13 Nov 2007 00:11

Beginning processing for Domain "2bs2A02"

Insertion by auto on 12 Nov 2007 21:58

Final ChopClose added based on similarity with "1e7pA"