CATH Domain: 2bneB00 XML data for domain: 2bneB00

Molscript image for 2bneB00
2bneB00
PDB coordinates for domain 2bneB00

PDB 2bne, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.1160 Carbamate kinase
3.40.1160.10 Gene3D
3.40.1160.10.3
3.40.1160.10.3.1
3.40.1160.10.3.1.2
3.40.1160.10.3.1.2.1
3.40.1160.10.3.1.2.1.1

[top]
Segment boundaries for domain 2bneB00

Chopping figure for domain 2bneB00
DomainStart PDB ResidueStop PDB Residue
2bneB00 3 241

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.1160.10.3.1.2.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2va1B00 91.07 Pyrimidine metabolismUreaplasma parvumUridylate kinaseUridylate kinase [EC:2.7.4.22] 3.40.1160.10 235 34 95 1.66 1.74
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2bneB00
TNAKPVYKRILLKLSGEALQGTEFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMGMLA
TVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANVVLK
ATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLITE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2bneB00
MATNAKPVYKRILLKLSGEALQGTEGFGIDASILDRMAQEIKELVELGIQVGVVIGGGNLFRGAGLAKAGMNRVVGDHMG
MLATVMNGLAMRDALHRAYVNARLMSAIPLNGVCDSYSWAEAISLLRNNRVVILSAGTGNPFFTTDSAACLRGIEIEANV
VLKATKVDGVFTADPAKDPTATMYEQLTYSEVLEKELKVMDLAAFTLARDHKLPIRVFNMNKPGALRRVVMGEKEGTLIT
E
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 06 Nov 2006 09:20

Assigning to "3.40.1160.10" based on similarity with "2bneA00"

Flow stage update by auto on 06 Nov 2006 09:19

No in_process hits for Domain "2bneB00" ready to be processed

Update comment by auto on 06 Nov 2006 05:20

Domain "2bneB00" hits Domain "2bneA00" (100% over 100%) which is currently in process

Update comment by auto on 06 Nov 2006 01:26

Domain "2bneB00" hits Domain "2bnfB00" (95.0207468879668% over 100%) which is currently in process

Update comment by auto on 05 Nov 2006 21:21

Domain "2bneB00" hits Domain "2bnfA00" (95.0207468879668% over 100%) which is currently in process

Update comment by auto on 05 Nov 2006 17:22

Domain "2bneB00" hits Domain "2bndA00" (99.5850622406639% over 100%) which is currently in process

Update comment by auto on 05 Nov 2006 13:26

Domain "2bneB00" hits Domain "2bndB00" (99.5850622406639% over 100%) which is currently in process

Flow stage update by auto on 05 Nov 2006 13:24

Domain "2bneB00" hits Domain "2bndB00" (99.5850622406639% over 100%) which is currently in process

Flow stage update by auto on 05 Nov 2006 13:24

NW result present for Domain "2bneB00"

Flow stage update by auto on 02 Nov 2006 14:22

All required files are present for Domain "2bneB00"

Flow stage update by auto on 01 Nov 2006 21:55

Beginning processing for Domain "2bneB00"

Insertion by auto on 01 Nov 2006 21:20

Final ChopClose added based on similarity with "2bneA"