CATH Domain: 2bl9A00 XML data for domain: 2bl9A00

Molscript image for 2bl9A00
2bl9A00
PDB coordinates for domain 2bl9A00

PDB 2bl9, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.430 Dihydrofolate Reductase, subunit A
3.40.430.10 Dihydrofolate Reductase, subunit A Gene3D
3.40.430.10.12
3.40.430.10.12.1
3.40.430.10.12.1.1
3.40.430.10.12.1.1.1
3.40.430.10.12.1.1.1.1

[top]
Segment boundaries for domain 2bl9A00

Chopping figure for domain 2bl9A00
DomainStart PDB ResidueStop PDB Residue
2bl9A00 2 238

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.430.10.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1qzfA01 86.20 Pyrimidine metabolismThymidylate synthase [EC:2.1.1.45]One carbon pool by folateBifunctional dihydrofolate reductase-thymidylate synthaseFolate biosynthesis 3.40.430.10 176 30 80 1.96 2.43
1vdrA00 81.52 One carbon pool by folateDihydrofolate reductaseHaloferax volcaniiFolate biosynthesisDihydrofolate reductase [EC:1.5.1.3] 3.40.430.10 157 22 72 1.84 2.55
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2bl9A00
ENLSDVFDIYAICACCKVAPTSAGTKNEPFSPRTFRGLGNKGTLPWKCNSVDMKYFSSVTTYVDESKYEKLKWKRERYLR
MEAKLQNVVVMGRSSWESIPKQYKPLPNRINVVLSKTLTKEDVKEKVFIIDSIDDLLLLLKKLKYYKCFIIGGAQVYREC
LSRNLIKQIYFTRINGAYPCDVFFPEFDESEFRVTSVSEVYNSKGTTLDFLVYSKV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2bl9A00
MENLSDVFDIYAICACCKVAPTSAGTKNEPFSPRTFRGLGNKGTLPWKCNSVDMKYFSSVTTYVDESKYEKLKWKRERYL
RMEASQGGGDNTSGGDNTHGGDNADKLQNVVVMGRSSWESIPKQYKPLPNRINVVLSKTLTKEDVKEKVFIIDSIDDLLL
LLKKLKYYKCFIIGGAQVYRECLSRNLIKQIYFTRINGAYPCDVFFPEFDESEFRVTSVSEVYNSKGTTLDFLVYSKV
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 01 Nov 2006 14:52

Assigning to "3.40.430.10" based on similarity with "1j3iB00"

Flow stage update by auto on 31 Oct 2006 09:48

No in_process hits for Domain "2bl9A00" ready to be processed

Flow stage update by auto on 31 Oct 2006 09:48

NW result present for Domain "2bl9A00"

Flow stage update by auto on 28 Oct 2006 01:49

All required files are present for Domain "2bl9A00"

Flow stage update by auto on 27 Oct 2006 14:02

Beginning processing for Domain "2bl9A00"

Insertion by cuff on 27 Oct 2006 11:10

nice batch of choppings