CATH Domain: 2bkxA00 XML data for domain: 2bkxA00

Molscript image for 2bkxA00
2bkxA00
PDB coordinates for domain 2bkxA00

PDB 2bkx, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.50 Rossmann fold
3.40.50.1360 Gene3D
3.40.50.1360.1
3.40.50.1360.1.1
3.40.50.1360.1.1.1
3.40.50.1360.1.1.1.1
3.40.50.1360.1.1.1.1.1

[top]
Segment boundaries for domain 2bkxA00

Chopping figure for domain 2bkxA00
DomainStart PDB ResidueStop PDB Residue
2bkxA00 1 242

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.40.50.1360.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1fs5A00 92.11 Amino sugar and nucleotide sugar metabolismMetabolic pathwaysGlucosamine-6-phosphate deaminase [EC:3.5.99.6]Glucosamine-6-phosphate deaminaseGlucosamine-6-phosphate deaminase activity 3.40.50.1360 266 38 90 1.02 1.12
1y89A00 85.98 Pentose phosphate pathwayMetabolic pathways6-phosphogluconolactonase [EC:3.1.1.31]Vibrio choleraeDevB protein 3.40.50.1360 232 20 91 2.17 2.37
1vl1A00 85.56 Thermotoga maritima6-phosphogluconolactonase [EC:3.1.1.31]Pentose phosphate pathway6-phosphogluconolactonaseMetabolic pathways 3.40.50.1360 217 16 86 2.14 2.48
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2bkxA00
MKVMECQTYEELSQIAARITADTIKEKPDAVLGLATGGTPEGTYRQLIRLHQTENLSFQNITTVNLDEYAGLSSDDPNSY
HFYMNDRFFQHIDSKPSRHFIPNGNADDLEAECRRYEQLVDSLGDTDIQLLGIGRNGHIGFNEPGTSFKSRTHVVTLNEQ
TRQANARYFPSIDSVPKKALTMGIQTILSSKRILLLISGKSKAEAVRKLLEGNISEDFPASALHLHSDVTVLIDREAASL
RP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2bkxA00
MKVMECQTYEELSQIAARITADTIKEKPDAVLGLATGGTPEGTYRQLIRLHQTENLSFQNITTVNLDEYAGLSSDDPNSY
HFYMNDRFFQHIDSKPSRHFIPNGNADDLEAECRRYEQLVDSLGDTDIQLLGIGRNGHIGFNEPGTSFKSRTHVVTLNEQ
TRQANARYFPSIDSVPKKALTMGIQTILSSKRILLLISGKSKAEAVRKLLEGNISEDFPASALHLHSDVTVLIDREAASL
RP
BLAST against CATH

[top]
Domain History Events (13)

Domain assigned by auto on 10 Dec 2008 21:55

Assigning to "3.40.50.1360" based on similarity with "2bkvA00"

Flow stage update by auto on 10 Dec 2008 21:52

No in_process hits for Domain "2bkxA00" ready to be processed

Update comment by auto on 10 Dec 2008 21:46

Domain "2bkxA00" hits Domain "2bkvA00" (100% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 21:31

Domain "2bkxA00" hits Domain "2bkvB00" (100% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 21:11

Domain "2bkxA00" hits Domain "2ri1B00" (42.5531914893617% over 96.2809917355372%) which is currently in process

Update comment by auto on 10 Dec 2008 20:44

Domain "2bkxA00" hits Domain "2ri0A00" (42.7350427350427% over 96.2809917355372%) which is currently in process

Update comment by auto on 10 Dec 2008 20:26

Domain "2bkxA00" hits Domain "2ri0B00" (42.7350427350427% over 96.2809917355372%) which is currently in process

Update comment by auto on 10 Dec 2008 14:30

Domain "2bkxA00" hits Domain "2ri1A00" (42.5531914893617% over 96.2809917355372%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:17

Domain "2bkxA00" hits Domain "2ri1A00" (42.5531914893617% over 96.2809917355372%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:17

NW result present for Domain "2bkxA00"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "2bkxA00"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "2bkxA00"

Insertion by auto on 05 Dec 2008 18:03

Final ChopClose added based on similarity with "2bkvA"