Domain assigned by auto on 28 Apr 2006 20:54
Assigning to "3.40.190.80" based on similarity with "2bjiA02" (NWSI: 100, NWO: 100, SPS: 98.92, SPO: 99, RMSD: 0.18)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2bjiB01 | 2003 | 2146 |
| 2bjiB02 | 2147 | 2277 |
There are 5 matching structural neighberhood comparisons for CATH ID 3.40.190.80.1.1.1.1.1 (SIMAX score < 5)
>pdb|2bjiB02 QVSHQEDITKSLLVTELGSSRTPETVRIILSNIERLLCLPIHGIRGVGTAALNMCLVAAGAADAYYEMGIHCWDVAGAGI IVTEAGGVLLDVTGGPFDLMSRRVIASSNKTLAERIAKEIQIIPLQRDDED
Assigning to "3.40.190.80" based on similarity with "2bjiA02" (NWSI: 100, NWO: 100, SPS: 98.92, SPO: 99, RMSD: 0.18)
NW result present for Domain "2bjiB02"
All required files are present for Domain "2bjiB02"
Beginning processing for Domain "2bjiB02"