CATH Domain: 2bjiA01 XML data for domain: 2bjiA01

Molscript image for 2bjiA01
2bjiA01
PDB coordinates for domain 2bjiA01

PDB 2bji, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.540 Fructose-1,6-Bisphosphatase; Chain A, domain 1
3.30.540.10 Fructose-1,6-Bisphosphatase, subunit A, domain 1 Gene3D
3.30.540.10.3
3.30.540.10.3.1
3.30.540.10.3.1.1
3.30.540.10.3.1.1.1
3.30.540.10.3.1.1.1.1

[top]
Segment boundaries for domain 2bjiA01

Chopping figure for domain 2bjiA01
DomainStart PDB ResidueStop PDB Residue
2bjiA01 1003 1146
2bjiA02 1147 1275

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.540.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vdwA01 86.07 Pyrococcus horikoshiiStreptomycin biosynthesisMyo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]Putative uncharacterized protein PH1897Metabolic pathways 3.30.540.10 134 23 92 2.90 3.14
1lbvA01 85.76 Inositol-1-monophosphataseArchaeoglobus fulgidusStreptomycin biosynthesisMyo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]Metabolic pathways 3.30.540.10 138 21 93 3.21 3.45
3b8bA01 84.83 CysQ proteinCysQ, sulfite synthesis pathway proteinBacteroides thetaiotaomicron 3.30.540.10 138 20 84 3.60 4.25
1ka1A01 82.30 Sulfur metabolism3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]Hyperosmotic salinity responseMethionine biosynthetic process3'(2'),5'-bisphosphate nucleotidase activity 3.30.540.10 219 22 63 1.72 2.71
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2bjiA01
DPWQECMDYAVTLAGQAGEVVREALKNEMNIMVKSSPADLVTATDQKVEKMLITSIKEKYPSHSFIGEESVAAGEKSILT
DNPTWIIDPIDGTTNFVHGFPFVAVSIGFVVNKKMEFGIVYSCLEDKMYTGRKGKGAFCNGQKL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2bjiA01
MADPWQECMDYAVTLAGQAGEVVREALKNEMNIMVKSSPADLVTATDQKVEKMLITSIKEKYPSHSFIGEESVAAGEKSI
LTDNPTWIIDPIDGTTNFVHGFPFVAVSIGFVVNKKMEFGIVYSCLEDKMYTGRKGKGAFCNGQKL
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 20:54

Assigning to "3.30.540.10" based on similarity with "2bjiB01" (NWSI: 100, NWO: 100, SPS: 98.74, SPO: 100, RMSD: 0.22)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "2bjiA01"

Flow stage update by auto on 28 Apr 2006 17:47

All required files are present for Domain "2bjiA01"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "2bjiA01"

Insertion by auto on 10 Mar 2006 02:57

Final ChopClose added based on similarity with "1awbA" [LEE: 2, LME: 0, MR: 0, LG: 2, SS: 95.69, SI: 88.4057971014493, SO: 99.6389891696751]