CATH Domain: 2bj0A00 XML data for domain: 2bj0A00

Molscript image for 2bj0A00
2bj0A00
PDB coordinates for domain 2bj0A00

PDB 2bj0, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.70 Distorted Sandwich
2.70.170 Acetylcholine Binding Protein; Chain: A,
2.70.170.10 Gene3D
2.70.170.10.1
2.70.170.10.1.1
2.70.170.10.1.1.1
2.70.170.10.1.1.1.1
2.70.170.10.1.1.1.1.1

Segment boundaries for domain 2bj0A00

Chopping figure for domain 2bj0A00
DomainStart PDB ResidueStop PDB Residue
2bj0A00 1 203

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 2.70.170.10.1.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3eamA01 82.83 Glr4197 proteinGloeobacter violaceus 2.70.170.10 192 16 90 2.87 3.17
2vl0A01 82.09 2.70.170.10 189 14 82 2.51 3.03
2bg9B01 81.40 Acetylcholine receptor beta subunitTorpedo marmorata 2.70.170.10 207 14 93 2.99 3.19
Displaying entries 1 to 3 (page 1 of 1)


Domain ATOM Sequence

>pdb|2bj0A00
QIRWTLLNQITGESDVIPLSNNTPLNVSLNFKLMNIVEADTEKDQVEVVLWTQASWKVPYYSSLLSSSSLDQVSLPVSKM
WTPDLSFYNAIAAPELLSADRVVVSKDGSVIYVPSQRVRFTCDLINVDTEPGATCRIKVGSWTHDNKQFALITGEEGVVN
IAEYFDSPKFDLLSATQSLNRKKYSCCENMYDDIEITFAFRKK    

Domain COMBS Sequence

>pdb|2bj0A00
QIRWTLLNQITGESDVIPLSNNTPLNVSLNFKLMNIVEADTEKDQVEVVLWTQASWKVPYYSSLLSSSSLDQVSLPVSKM
WTPDLSFYNAIAAPELLSADRVVVSKDGSVIYVPSQRVRFTCDLINVDTEPGATCRIKVGSWTHDNKQFALITGEEGVVN
IAEYFDSPKFDLLSATQSLNRKKYSCCENMYDDIEITFAFRKK    

Domain History Events (14)

Domain assigned by auto on 02 Nov 2006 06:17

Assigning to "2.70.170.10" based on similarity with "2bj0C00"

Flow stage update by auto on 02 Nov 2006 06:12

No in_process hits for Domain "2bj0A00" ready to be processed

Update comment by auto on 02 Nov 2006 03:16

Domain "2bj0A00" hits Domain "2bj0B00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 21:56

Domain "2bj0A00" hits Domain "2bj0E00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 18:04

Domain "2bj0A00" hits Domain "2bj0D00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 14:27

Domain "2bj0A00" hits Domain "2bj0C00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "2bj0A00" hits Domain "2bj0C00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:49

Domain "2bj0A00" hits Domain "2bj0C00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:09

Domain "2bj0A00" hits Domain "2bj0C00" (100% over 100%) which is currently in process

Flow stage update by auto on 31 Oct 2006 09:48

Domain "2bj0A00" hits Domain "2bj0C00" (100% over 100%) which is currently in process

Flow stage update by auto on 31 Oct 2006 09:48

NW result present for Domain "2bj0A00"

Flow stage update by auto on 28 Oct 2006 13:45

All required files are present for Domain "2bj0A00"

Flow stage update by auto on 28 Oct 2006 01:49

Beginning processing for Domain "2bj0A00"

Insertion by auto on 27 Oct 2006 21:18

Final ChopClose added based on similarity with "2bj0B"