CATH Domain: 2bdgA01 XML data for domain: 2bdgA01

Molscript image for 2bdgA01
2bdgA01
PDB coordinates for domain 2bdgA01

PDB 2bdg, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.10 Thrombin, subunit H
2.40.10.10 Trypsin-like serine proteases Gene3D
2.40.10.10.4
2.40.10.10.4.6
2.40.10.10.4.6.1
2.40.10.10.4.6.1.1
2.40.10.10.4.6.1.1.1

[top]
Segment boundaries for domain 2bdgA01

Chopping figure for domain 2bdgA01
DomainStart PDB ResidueStop PDB Residue
2bdgA01 16 27
2bdgA01 121 234
2bdgA02 28 120
2bdgA02 235 244

Structural Neighbourhood (26 entries)

There are 26 matching structural neighberhood comparisons for CATH ID 2.40.10.10.4.6.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 26 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1eaxA01 92.84 Suppressor of tumorigenicity protein 14 [EC:3.4.21.109]Integral to plasma membraneSuppressor of tumorigenicity 14 proteinHomo sapiensProteolysis 2.40.10.10 126 39 94 1.24 1.31
1k2i101 91.88 Bos taurusChymotrypsinogen A 2.40.10.10 118 39 92 1.34 1.45
1bioA01 91.62 Serine-type endopeptidase activityHomo sapiensComponent factor D [EC:3.4.21.46]Complement and coagulation cascadesComplement factor D 2.40.10.10 122 35 95 1.53 1.60
1eq9A01 91.02 Chymotrypsin-1Solenopsis invicta 2.40.10.10 117 33 96 1.45 1.50
2o8tA01 90.92 Regulation of smooth muscle cell migrationCell surfaceUrokinase-type plasminogen activatorSignal transductionProteolysis 2.40.10.10 128 45 93 1.56 1.66
2bvrH01 90.69 FibrinolysisSerine-type endopeptidase activityProthrombinSoluble fractionPositive regulation of protein phosphorylation 2.40.10.10 132 40 89 1.73 1.94
1a7sA01 89.43 AzurocidinPositive regulation of phagocytosisAzurophil granuleMonocyte activationPositive regulation of tumor necrosis factor biosynthetic process 2.40.10.10 112 30 91 1.87 2.04
1gvkB01 89.29 Sus scrofaChymotrypsin-like elastase family member 1Protein binding 2.40.10.10 128 33 92 1.45 1.57
1q3xA02 89.16 Serine-type endopeptidase activityHomo sapiensMannan-binding lectin serine protease 2Calcium-dependent protein bindingComplement activation, lectin pathway 2.40.10.10 137 38 86 1.68 1.95
1elvA02 89.09 Serine-type endopeptidase activitySystemic lupus erythematosusComplement C1s subcomponentHomo sapiensComplement component 1, s subcomponent [EC:3.4.21.42] 2.40.10.10 126 35 89 2.21 2.46
2asuB01 88.96 Hepatocyte growth factor-like proteinHomo sapiens 2.40.10.10 122 33 94 2.18 2.31
3gylB01 88.87 ProstasinPlasma membraneProtease, serine, 8 (prostasin) [EC:3.4.21.-]Homo sapiensExtracellular space 2.40.10.10 133 43 89 2.00 2.24
2hlcA02 88.54 CollagenaseHypoderma lineatum 2.40.10.10 126 30 90 1.78 1.97
1si5H01 88.15 Pathways in cancerHepatocyte growth factorEpithelial to mesenchymal transitionRenal cell carcinomaCytokine-cytokine receptor interaction 2.40.10.10 119 30 93 2.19 2.35
1gvzA01 88.08 Equus caballusKallikrein-1E2 2.40.10.10 121 36 99 2.93 2.95
1nn6A01 85.62 ChymaseChymase [EC:3.4.21.39]Homo sapiensRenin-angiotensin systemInterleukin-1 beta biosynthetic process 2.40.10.10 114 28 92 2.81 3.04
1yphE00 85.09 Bos taurusChymotrypsinogen A 2.40.10.10 97 39 65 1.31 1.99
2o8lA01 81.55 Glutamyl endopeptidase [EC:3.4.21.19]Glutamyl endopeptidaseStaphylococcus aureus subsp. aureus Mu50 2.40.10.10 115 10 76 2.36 3.08
1y8tB02 81.00 Two-component systemPutative serine protease PepD [EC:3.4.21.-]PROBABLE SERINE PROTEASE PEPD (SERINE PROTEINASE) (MTB32B)Mycobacterium tuberculosis 2.40.10.10 111 15 74 3.14 4.23
2qf3B02 80.24 Protease degSProtein bindingSerine protease DegS [EC:3.4.21.-]Escherichia coli K-12 2.40.10.10 103 15 75 3.03 4.04
1arbA01 79.72 Achromobacter lyticusProtease 1 2.40.10.10 122 9 87 3.90 4.45
1p3cA01 79.53 Glutamyl-endopeptidaseBacillus intermedius 2.40.10.10 102 16 80 3.27 4.09
1dleB02 78.37 Complement factor BComplement bindingHomo sapiensComponent factor B [EC:3.4.21.47]Complement and coagulation cascades 2.40.10.10 142 18 67 2.41 3.56
2halA02 77.07 Human hepatitis A virus Hu/Australia/HM175/1976Genome polyprotein 2.40.10.10 103 10 70 3.31 4.73
1svpA02 72.27 Sindbis virusStructural polyprotein 2.40.10.10 86 11 57 2.44 4.24
3fanA02 71.28 Porcine reproductive and respiratory syndrome virusNon-structural protein 2.40.10.10 69 18 51 2.29 4.43
[1]
Displaying entries 1 to 26 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2bdgA01
IINGEDCSPHSQISIASQCPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSKLYDPLYHPSMFCAGGGQDQKDS
CNGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2bdgA01
IINGEDCSPHSQISIASQCPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSKLYDPLYHPSMFCAGGGQDQKDS
CNGDSGGPLICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKF
BLAST against CATH

[top]
Domain History Events (41)

Domain assigned by auto on 15 Aug 2007 09:52

Assigning to "2.40.10.10" based on similarity with "2bdhA01"

Flow stage update by auto on 15 Aug 2007 09:51

No in_process hits for Domain "2bdgA01" ready to be processed

Update comment by auto on 15 Aug 2007 09:49

Domain "2bdgA01" hits Domain "2a32A01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 09:47

Domain "2bdgA01" hits Domain "2aiqA01" (40.5405405405405% over 91.7355371900826%) which is currently in process

Update comment by auto on 15 Aug 2007 09:45

Domain "2bdgA01" hits Domain "1zr0A01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 09:43

Domain "2bdgA01" hits Domain "1zr0C01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 09:41

Domain "2bdgA01" hits Domain "2blvA01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 09:38

Domain "2bdgA01" hits Domain "1yp9A01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 09:35

Domain "2bdgA01" hits Domain "1ylcA01" (40.8333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 09:32

Domain "2bdgA01" hits Domain "1yldA01" (40.8333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 09:30

Domain "2bdgA01" hits Domain "1yktA01" (40.8333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 09:27

Domain "2bdgA01" hits Domain "1y5uT01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 09:24

Domain "2bdgA01" hits Domain "1y59T01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 09:21

Domain "2bdgA01" hits Domain "1y5aT01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 09:17

Domain "2bdgA01" hits Domain "1y5bT01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 09:13

Domain "2bdgA01" hits Domain "1y3yA01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 09:09

Domain "2bdgA01" hits Domain "1y3uA01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 09:05

Domain "2bdgA01" hits Domain "1y3vA01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 08:59

Domain "2bdgA01" hits Domain "1y3wA01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 08:46

Domain "2bdgA01" hits Domain "1tx6B01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 08:27

Domain "2bdgA01" hits Domain "1tx7A01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 08:05

Domain "2bdgA01" hits Domain "1tx6C01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 07:40

Domain "2bdgA01" hits Domain "1tx6D01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 07:12

Domain "2bdgA01" hits Domain "1tx8A01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 06:52

Domain "2bdgA01" hits Domain "1spjA01" (38.8429752066116% over 98.3471074380165%) which is currently in process

Update comment by auto on 15 Aug 2007 06:30

Domain "2bdgA01" hits Domain "1s0qA01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 06:04

Domain "2bdgA01" hits Domain "1s0rA01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 05:35

Domain "2bdgA01" hits Domain "1v6dA01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Update comment by auto on 15 Aug 2007 05:05

Domain "2bdgA01" hits Domain "1op0A01" (42.1487603305785% over 97.5409836065574%) which is currently in process

Update comment by auto on 15 Aug 2007 04:34

Domain "2bdgA01" hits Domain "1sgfG01" (42.9752066115703% over 98.3471074380165%) which is currently in process

Update comment by auto on 15 Aug 2007 03:59

Domain "2bdgA01" hits Domain "1sgfA01" (38.8429752066116% over 97.5409836065574%) which is currently in process

Update comment by auto on 15 Aug 2007 03:19

Domain "2bdgA01" hits Domain "1sgfX01" (38.8429752066116% over 97.5409836065574%) which is currently in process

Update comment by auto on 15 Aug 2007 02:37

Domain "2bdgA01" hits Domain "1sgfZ01" (42.9752066115703% over 98.3471074380165%) which is currently in process

Update comment by auto on 15 Aug 2007 01:31

Domain "2bdgA01" hits Domain "1tpiZ01" (43.801652892562% over 93.6507936507936%) which is currently in process

Update comment by auto on 15 Aug 2007 00:03

Domain "2bdgA01" hits Domain "1tgpZ01" (43.801652892562% over 93.6507936507936%) which is currently in process

Update comment by auto on 14 Aug 2007 22:48

Domain "2bdgA01" hits Domain "1tga001" (43.801652892562% over 93.6507936507936%) which is currently in process

Flow stage update by auto on 08 Aug 2007 02:37

Domain "2bdgA01" hits Domain "2agiX01" (43.3333333333333% over 97.5206611570248%) which is currently in process

Flow stage update by auto on 08 Aug 2007 02:36

NW result present for Domain "2bdgA01"

Flow stage update by auto on 24 Jul 2007 22:29

All required files are present for Domain "2bdgA01"

Flow stage update by auto on 24 Jul 2007 06:41

Beginning processing for Domain "2bdgA01"

Insertion by auto on 24 Jul 2007 06:18

Final ChopClose added based on similarity with "2bdhA"