CATH Domain: 2bcqA03 XML data for domain: 2bcqA03

Molscript image for 2bcqA03
2bcqA03
PDB coordinates for domain 2bcqA03

PDB 2bcq, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.460 Beta Polymerase; domain 2
3.30.460.10 Beta Polymerase, domain 2 Gene3D
3.30.460.10.1
3.30.460.10.1.1
3.30.460.10.1.1.1
3.30.460.10.1.1.1.1
3.30.460.10.1.1.1.1.1

[top]
Segment boundaries for domain 2bcqA03

Chopping figure for domain 2bcqA03
DomainStart PDB ResidueStop PDB Residue
2bcqA01 252 331
2bcqA02 332 385
2bcqA03 386 508
2bcqA04 509 575

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.460.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1jmsA03 85.71 Mus musculusDNA nucleotidylexotransferase activityNucleusDNA nucleotidylexotransferase 3.30.460.10 136 26 80 2.42 3.02
1knyA01 79.67 Staphylococcus aureusKanamycin nucleotidyltransferase 3.30.460.10 125 8 68 3.17 4.61
2o5aA01 78.80 Hypothetical proteinBacillus haloduransBH1328 protein 3.30.460.10 101 10 79 3.54 4.44
1jajA01 78.36 Repair DNA polymerase XAfrican swine fever virus BA71V 3.30.460.10 105 18 79 3.74 4.69
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2bcqA03
RMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQE
ENGQQQKYLGVCRLPGPGRRHRRLDIIVVPYSEFACALLYFTG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2bcqA03
RMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQE
ENGQQQKYLGVCRLPGPGRRHRRLDIIVVPYSEFACALLYFTG
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 21:54

Assigning to "3.30.460.10" based on similarity with "1rztM03" (NWSI: 100, NWO: 100, SPS: 95.83, SPO: 100, RMSD: 1.90)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "2bcqA03"

Flow stage update by auto on 28 Apr 2006 17:49

All required files are present for Domain "2bcqA03"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "2bcqA03"

Insertion by auto on 17 Mar 2006 19:52

Final ChopClose added based on similarity with "1xslA" [LEE: 0, LME: 0, MR: 3, LG: 3, SS: 93.23, SI: 100, SO: 100]