CATH Domain: 2bcqA02 XML data for domain: 2bcqA02

Molscript image for 2bcqA02
2bcqA02
PDB coordinates for domain 2bcqA02

PDB 2bcq, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.20 5' to 3' exonuclease, C-terminal subdomain Gene3D
1.10.150.20.13
1.10.150.20.13.1
1.10.150.20.13.1.1
1.10.150.20.13.1.1.1
1.10.150.20.13.1.1.1.1

[top]
Segment boundaries for domain 2bcqA02

Chopping figure for domain 2bcqA02
DomainStart PDB ResidueStop PDB Residue
2bcqA01 252 331
2bcqA02 332 385
2bcqA03 386 508
2bcqA04 509 575

Structural Neighbourhood (6 entries)

There are 6 matching structural neighberhood comparisons for CATH ID 1.10.150.20.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 6 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2q0zX02 84.99 ATP-dependent helicase activityPre-mRNA-splicing helicase BRR2 [EC:3.6.1.-]Protein bindingU5 small nuclear ribonucleoprotein 200 kDa helicaseU5 snRNP 1.10.150.20 56 11 82 2.80 3.41
1wcnA01 82.39 N utilization substance protein ATranscription elongation protein nusAEscherichia coli K-12 1.10.150.20 60 14 80 2.91 3.64
1dxsA00 81.11 DNA damage response, signal transduction resulting in induction of apoptosisTranscription factor bindingProtein bindingPositive regulation of transcription, DNA-dependentMismatch repair 1.10.150.50 57 9 77 2.78 3.60
1dgsA05 79.32 DNA ligaseThermus filiformis 1.10.150.20 69 16 71 2.46 3.46
1x9xA00 77.61 MAPK signaling pathway - yeastSAM domain bindingIdentical protein bindingInvasive growth in response to glucose limitationActivation of MAPKK activity 1.10.150.50 62 11 77 3.83 4.95
1z1vA00 75.73 Protein kinase regulator activitySAM domain bindingProtein STE50Signal transduction involved in filamentous growthPheromone-dependent signal transduction involved in conjugation with cellular fusion 1.10.150.50 70 7 72 3.52 4.83
[1]
Displaying entries 1 to 6 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2bcqA02
VPVLELFSNIWGAGTKTAQMWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2bcqA02
VPVLELFSNIWGAGTKTAQMWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLE
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 21:54

Assigning to "1.10.150.20" based on similarity with "1rztA02" (NWSI: 100, NWO: 100, SPS: 98.71, SPO: 100, RMSD: 0.30)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "2bcqA02"

Flow stage update by auto on 28 Apr 2006 17:49

All required files are present for Domain "2bcqA02"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "2bcqA02"

Insertion by auto on 17 Mar 2006 19:52

Final ChopClose added based on similarity with "1xslA" [LEE: 0, LME: 0, MR: 3, LG: 3, SS: 93.23, SI: 100, SO: 100]