CATH Domain: 2bayE00 XML data for domain: 2bayE00

Molscript image for 2bayE00
2bayE00
PDB coordinates for domain 2bayE00

PDB 2bay, Chain E, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.40 Herpes Virus-1
3.30.40.10 Zinc/RING finger domain, C3HC4 (zinc finger) Gene3D
3.30.40.10.4
3.30.40.10.4.1
3.30.40.10.4.1.1
3.30.40.10.4.1.1.1
3.30.40.10.4.1.1.1.1

[top]
Segment boundaries for domain 2bayE00

Chopping figure for domain 2bayE00
DomainStart PDB ResidueStop PDB Residue
2bayE00 -2 56

Structural Neighbourhood (12 entries)

There are 12 matching structural neighberhood comparisons for CATH ID 3.30.40.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 12 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1rmdA01 83.99 Endonuclease activityZinc ion bindingPre-B cell allelic exclusionNegative regulation of caspase activityV(D)J recombination-activating protein 1 3.30.40.10 86 16 67 2.11 3.13
1iymA00 83.89 Oryza sativa Japonica GroupE3 ubiquitin-protein ligase EL5 3.30.40.10 55 9 84 2.83 3.34
1chcA00 82.27 Equine herpesvirus type 1 (strain AB4P)Trans-acting transcriptional protein ICP0 3.30.40.10 68 15 83 2.86 3.41
1vyxA00 79.51 Human herpesvirus 8E3 ubiquitin-protein ligase MIR1 3.30.40.10 60 10 86 4.30 4.96
3dplR00 79.47 Nucleotide excision repairUbiquitin mediated proteolysisWnt signaling pathwayTGF-beta signaling pathwayOocyte meiosis 3.30.40.10 87 13 62 1.94 3.13
1fbvA02 79.35 Jak-STAT signaling pathwayPathways in cancerT cell receptor signaling pathwayErbB signaling pathwayChronic myeloid leukemia 3.30.40.10 76 13 71 3.29 4.63
1z60A00 78.63 Nucleotide excision repairProtein N-terminus bindingG-protein coupled receptor internalizationBasal transcription factorsTranslation factor activity, nucleic acid binding 3.10.370.10 59 5 76 3.41 4.47
1t1hA00 78.06 Arabidopsis thalianaU-box domain-containing protein 14Ubiquitin-protein ligase activity 3.30.40.10 78 16 74 3.02 4.06
1g25A00 76.01 CDK-activating kinase assembly factor MAT1Positive regulation of transcription from RNA polymerase II promoterZinc ion bindingProtein N-terminus bindingNucleotide excision repair 3.30.40.10 65 3 86 3.99 4.63
1jm7A00 75.66 DNA damage response, signal transduction resulting in induction of apoptosisPositive regulation of DNA repairProtein ubiquitinationZinc ion bindingBreast cancer type 1 susceptibility protein 3.30.40.10 103 18 56 2.51 4.46
1jm7B00 74.14 BRCA1-associated RING domain protein 1Protein homodimerization activityRNA bindingBRCA1-A complexTissue homeostasis 3.30.40.10 97 16 57 2.83 4.90
1twfL00 73.24 Pyrimidine metabolismPurine metabolismRNA polymeraseMetabolic pathwaysTranscription from RNA polymerase II promoter 2.20.28.30 46 2 64 3.15 4.89
[1]
Displaying entries 1 to 12 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2bayE00
GSHMLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2bayE00
GSHMLCAISGKVPRRPVLSPKSRTIFEKSLLEQYVKDTGNDPITNEPLSIEEIVEIVPSAQ
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 21:53

Assigning to "3.30.40.10" based on similarity with "2bayC00" (NWSI: 100, NWO: 100, SPS: 96.92, SPO: 93, RMSD: 0.35)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "2bayE00"

Flow stage update by auto on 28 Apr 2006 17:49

All required files are present for Domain "2bayE00"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "2bayE00"

Insertion by auto on 15 Mar 2006 02:52

Final ChopClose added based on similarity with "2bayA" [LEE: 3, LME: 0, MR: 0, LG: 3, SS: 96.43, SI: 100, SO: 100]