Domain assigned by auto on 28 Apr 2006 21:49
Assigning to "3.40.190.10" based on similarity with "1nkxA01" (NWSI: 100, NWO: 100, SPS: 98.22, SPO: 100, RMSD: 0.39)
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2b6dA01 | 343 | 414 |
| 2b6dA01 | 596 | 657 |
| 2b6dA02 | 415 | 595 |
| 2b6dA02 | 658 | 668 |
There are 8 matching structural neighberhood comparisons for CATH ID 3.40.190.10.12.1.1.1.48 (SIMAX score < 5)
>pdb|2b6dA01 TRVVWCAVGPEEQKKCQQWSQQSGQNVTCATASTTDDCIVLVLKGEADALNLDGGYIYTAGKCGLVPVLAENAVVSRSDR AAHVEQVLLHQQALFGKNGKNCPDKFCLFKSETKNLLFNDNTECLAKLGGRPTY
Assigning to "3.40.190.10" based on similarity with "1nkxA01" (NWSI: 100, NWO: 100, SPS: 98.22, SPO: 100, RMSD: 0.39)
NW result present for Domain "2b6dA01"
All required files are present for Domain "2b6dA01"
Beginning processing for Domain "2b6dA01"