CATH Domain: 2avaA00 XML data for domain: 2avaA00

Molscript image for 2avaA00
2avaA00
PDB coordinates for domain 2avaA00

PDB 2ava, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.1200 Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A
1.10.1200.10 Gene3D
1.10.1200.10.5
1.10.1200.10.5.1
1.10.1200.10.5.1.1
1.10.1200.10.5.1.1.1
1.10.1200.10.5.1.1.1.1

[top]
Segment boundaries for domain 2avaA00

Chopping figure for domain 2avaA00
DomainStart PDB ResidueStop PDB Residue
2avaA00 1 82

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.10.1200.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2cnrA00 82.21 Acyl carrier proteinAcyl carrier proteinStreptomyces coelicolor 1.10.1200.10 82 20 95 3.71 3.90
1dnyA00 77.75 Brevibacillus parabrevisTyrocidine synthase 3 1.10.1200.10 76 10 84 3.83 4.55
1qx2A00 75.40 Protein S100-GBos taurus 1.10.238.10 75 4 74 3.36 4.52
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2avaA00
AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEK
KA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2avaA00
AKKETIDKVSDIVKEKLALGADVVVTADSEFSKLGADSLDTVEIVMNLEEEFGINVDEDKAQDISTIQQAADVIEGLLEK
KA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 21 Jul 2007 07:05

Assigning to "1.10.1200.10" based on similarity with "1t8kA00"

Flow stage update by auto on 21 Jul 2007 07:01

No in_process hits for Domain "2avaA00" ready to be processed

Flow stage update by auto on 21 Jul 2007 07:01

NW result present for Domain "2avaA00"

Flow stage update by auto on 14 Jul 2007 06:01

All required files are present for Domain "2avaA00"

Flow stage update by auto on 13 Jul 2007 18:42

Beginning processing for Domain "2avaA00"

Insertion by auto on 13 Jul 2007 04:03

Final ChopClose added based on similarity with "1t8kA"