CATH Domain: 2au7A00 XML data for domain: 2au7A00

Molscript image for 2au7A00
2au7A00
PDB coordinates for domain 2au7A00

PDB 2au7, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.80 Inorganic Pyrophosphatase
3.90.80.10 Inorganic Pyrophosphatase Gene3D
3.90.80.10.1
3.90.80.10.1.1
3.90.80.10.1.1.1
3.90.80.10.1.1.1.1
3.90.80.10.1.1.1.1.1

[top]
Segment boundaries for domain 2au7A00

Chopping figure for domain 2au7A00
DomainStart PDB ResidueStop PDB Residue
2au7A00 1 175

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.90.80.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1e9gB00 80.49 Oxidative phosphorylationProtein homodimerization activityInorganic pyrophosphataseInorganic pyrophosphatase [EC:3.6.1.1]Saccharomyces cerevisiae 3.90.80.10 283 24 60 1.90 3.14
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2au7A00
SLLNVPAGKDLPEDIYVVIEIPANADPIKYEIDKESGALFVDQFMSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQ
PGSVTRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDHIKDVNDLPELLKAQIAHFFEHYKDLEKGKWVKVEGWENAEA
AKAEIVASFERAKNK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2au7A00
SLLNVPAGKDLPEDIYVVIEIPANADPIKYEIDKESGALFVDQFMSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQ
PGSVTRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDHIKDVNDLPELLKAQIAHFFEHYKDLEKGKWVKVEGWENAEA
AKAEIVASFERAKNK
BLAST against CATH

[top]
Domain History Events (15)

Domain assigned by auto on 15 Aug 2007 05:43

Assigning to "3.90.80.10" based on similarity with "1i40A00"

Flow stage update by auto on 15 Aug 2007 05:35

No in_process hits for Domain "2au7A00" ready to be processed

Update comment by auto on 15 Aug 2007 05:05

Domain "2au7A00" hits Domain "2au8A00" (99.4285714285714% over 100%) which is currently in process

Update comment by auto on 15 Aug 2007 04:33

Domain "2au7A00" hits Domain "2bqyA00" (45.0867052023121% over 98.8571428571429%) which is currently in process

Update comment by auto on 15 Aug 2007 03:59

Domain "2au7A00" hits Domain "1ygzF00" (44.5086705202312% over 98.8571428571429%) which is currently in process

Update comment by auto on 15 Aug 2007 03:19

Domain "2au7A00" hits Domain "1ygzA00" (44.5086705202312% over 98.8571428571429%) which is currently in process

Update comment by auto on 15 Aug 2007 02:36

Domain "2au7A00" hits Domain "1ygzD00" (44.5086705202312% over 98.8571428571429%) which is currently in process

Update comment by auto on 15 Aug 2007 01:31

Domain "2au7A00" hits Domain "1ygzE00" (44.5086705202312% over 98.8571428571429%) which is currently in process

Update comment by auto on 15 Aug 2007 00:02

Domain "2au7A00" hits Domain "1ygzC00" (44.5086705202312% over 98.8571428571429%) which is currently in process

Update comment by auto on 14 Aug 2007 22:48

Domain "2au7A00" hits Domain "1wcfA00" (41.5204678362573% over 96.5714285714286%) which is currently in process

Flow stage update by auto on 21 Jul 2007 07:01

Domain "2au7A00" hits Domain "2au9A00" (99.4285714285714% over 100%) which is currently in process

Flow stage update by auto on 21 Jul 2007 07:01

NW result present for Domain "2au7A00"

Flow stage update by auto on 16 Jul 2007 22:37

All required files are present for Domain "2au7A00"

Flow stage update by auto on 15 Jul 2007 22:37

Beginning processing for Domain "2au7A00"

Insertion by auto on 15 Jul 2007 22:09

Final ChopClose added based on similarity with "1i40A"