Domain assigned by auto on 18 Dec 2006 07:33
Assigning to "2.40.10.10" based on similarity with "1bmlA01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2asuB01 | 484 | 492 |
| 2asuB01 | 587 | 699 |
| 2asuB02 | 493 | 586 |
| 2asuB02 | 700 | 708 |
There are 7 matching structural neighberhood comparisons for CATH ID 2.40.10.10.59.1.1.1.1 (SIMAX score < 5)
>pdb|2asuB01 VVGGHPGNSICLPPEWYVVPPGTKCEIAGWGETKGTGNDTVLNVALLNVISNQECNIKHRGRVRESEMCTEGLLAPVGAC EGDYGGPLACFTHNSWVLEGIIIPNRVCARSRWPAVFTRVSV
Assigning to "2.40.10.10" based on similarity with "1bmlA01"
No in_process hits for Domain "2asuB01" ready to be processed
NW result present for Domain "2asuB01"
All required files are present for Domain "2asuB01"
Beginning processing for Domain "2asuB01"
small selection of choppings