CATH Domain: 2arrA01 XML data for domain: 2arrA01

Molscript image for 2arrA01
2arrA01
PDB coordinates for domain 2arrA01

PDB 2arr, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.497 Antithrombin; Chain I, domain 2
3.30.497.10 Antithrombin, subunit I, domain 2 Gene3D
3.30.497.10.2
3.30.497.10.2.1
3.30.497.10.2.1.1
3.30.497.10.2.1.1.1
3.30.497.10.2.1.1.1.1

[top]
Segment boundaries for domain 2arrA01

Chopping figure for domain 2arrA01
DomainStart PDB ResidueStop PDB Residue
2arrA01 3 207
2arrA01 310 364
2arrA02 208 309
2arrA02 382 411

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 3.30.497.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3dy0A01 91.01 MembraneAcrosin bindingHeparin bindingExtracellular regionSerine-type endopeptidase inhibitor activity 3.30.497.10 217 32 95 1.66 1.74
3f02B01 89.75 Peripheral nervous system developmentNeuroserpinHomo sapiensCentral nervous system developmentSerine-type endopeptidase inhibitor activity 3.30.497.10 219 27 91 2.03 2.22
1wz9A01 89.40 CytoplasmCellular component movementP53 signaling pathwaySerpin peptidase inhibitor, clade B, member 5Homo sapiens 3.30.497.10 219 32 97 2.31 2.37
1lj5A01 87.91 Plasminogen activator inhibitor-1Positive regulation of monocyte chemotaxisChagas diseaseCellular response to chemical stimulusNegative regulation of endopeptidase activity 3.30.497.10 225 27 94 3.89 4.13
1uhgA02 87.73 OvalbuminGallus gallus 3.30.497.10 232 35 93 2.62 2.80
1jmoA01 86.69 Heparin cofactor IIHomo sapiensHeparin cofactor 2Complement and coagulation cascades 3.30.497.10 227 31 92 2.52 2.71
2b5tI01 86.15 Antithrombin IIIProtease bindingHomo sapiensAntithrombin-IIIExtracellular space 3.30.497.10 259 36 85 2.08 2.43
1k9oI01 85.72 Manduca sextaAlaserpinProtein binding 3.30.497.10 215 26 92 2.64 2.85
1imvA02 85.33 Negative regulation of angiogenesisHomo sapiensPigment epithelium-derived factorPositive regulation of neurogenesisCell proliferation 3.30.497.10 206 22 89 2.44 2.72
1jjoC01 80.11 Mus musculusNeuroserpin 3.30.497.10 149 27 56 1.50 2.64
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2arrA01
DLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMASVLQFNEVKIHSSFRSLSSAINASTGN
YLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAEEARKKINSWVKTQTKGKIPNLLPEGSVDGDTRMVLVN
AVYFKGKPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2arrA01
MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMASVLQFNEVGAAADKIHSSFRSLSSA
INASTGNYLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAEEARKKINSWVKTQTKGKIPNLLPEGSVDGD
TRMVLVNAVYFKGKPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMVDVNE
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 30 Nov 2006 13:31

Assigning to "3.30.497.10" based on similarity with "1by7A02"

Flow stage update by auto on 30 Nov 2006 13:27

No in_process hits for Domain "2arrA01" ready to be processed

Flow stage update by auto on 30 Nov 2006 13:27

NW result present for Domain "2arrA01"

Flow stage update by auto on 29 Nov 2006 13:24

All required files are present for Domain "2arrA01"

Flow stage update by auto on 28 Nov 2006 21:32

Beginning processing for Domain "2arrA01"

Insertion by auto on 28 Nov 2006 21:25

Final ChopClose added based on similarity with "2arqA"