CATH Domain: 2aqmA00 XML data for domain: 2aqmA00

Molscript image for 2aqmA00
2aqmA00
PDB coordinates for domain 2aqmA00

PDB 2aqm, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.40 Immunoglobulin-like
2.60.40.200 Gene3D
2.60.40.200.2
2.60.40.200.2.1
2.60.40.200.2.1.1
2.60.40.200.2.1.1.1
2.60.40.200.2.1.1.1.1

[top]
Segment boundaries for domain 2aqmA00

Chopping figure for domain 2aqmA00
DomainStart PDB ResidueStop PDB Residue
2aqmA00 1 154

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 2.60.40.200.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1s4iA00 87.55 Cu/Zn superoxide dismutase [EC:1.15.1.1]Bacillus subtilisSuperoxide dismutase-like protein yojM 2.60.40.200 151 30 91 2.50 2.73
1pzsA00 86.13 Cu/Zn superoxide dismutase [EC:1.15.1.1]Superoxide dismutase [Cu-Zn]Mycobacterium tuberculosis 2.60.40.200 171 27 83 2.35 2.81
2jlpB00 84.28 Superoxide dismutase [EC:1.15.1.1]Extracellular superoxide dismutase [Cu-Zn]Soluble fractionSuperoxide dismutase activityHomo sapiens 2.60.40.200 166 19 83 3.06 3.65
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2aqmA00
ESTTVKMYEALPTGPGKEVGTVVISEAPGGLHFKVNMEKLTPGYHGFHVHENPSCAPGEKDGKIVPALAAGGHYDPGNTH
HHLGPEGDGHMGDLPRLSANADGKVSETVVAPHLKKLAEIKQRSLMVHVGGDNYSDKPEPLGGGGARFACGVIE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2aqmA00
ESTTVKMYEALPTGPGKEVGTVVISEAPGGLHFKVNMEKLTPGYHGFHVHENPSCAPGEKDGKIVPALAAGGHYDPGNTH
HHLGPEGDGHMGDLPRLSANADGKVSETVVAPHLKKLAEIKQRSLMVHVGGDNYSDKPEPLGGGGARFACGVIE
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 15 Aug 2007 00:26

Assigning to "2.60.40.200" based on similarity with "1eqwA00"

Flow stage update by auto on 15 Aug 2007 00:02

No in_process hits for Domain "2aqmA00" ready to be processed

Update comment by auto on 14 Aug 2007 22:48

Domain "2aqmA00" hits Domain "2aqsA00" (48.7012987012987% over 93.9024390243902%) which is currently in process

Flow stage update by auto on 21 Jul 2007 07:01

Domain "2aqmA00" hits Domain "2aqsB00" (48.7012987012987% over 93.9024390243902%) which is currently in process

Flow stage update by auto on 21 Jul 2007 07:01

NW result present for Domain "2aqmA00"

Flow stage update by auto on 16 Jul 2007 22:37

All required files are present for Domain "2aqmA00"

Flow stage update by auto on 15 Jul 2007 22:37

Beginning processing for Domain "2aqmA00"

Insertion by auto on 15 Jul 2007 22:09

Final ChopClose added based on similarity with "1eqwA"