CATH Domain: 2apcA01 XML data for domain: 2apcA01

Molscript image for 2apcA01
2apcA01
PDB coordinates for domain 2apcA01

PDB 2apc, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.550 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A
3.90.550.10 Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Gene3D
3.90.550.10.9
3.90.550.10.9.1
3.90.550.10.9.1.1
3.90.550.10.9.1.1.1
3.90.550.10.9.1.1.1.1

Segment boundaries for domain 2apcA01

Chopping figure for domain 2apcA01
DomainStart PDB ResidueStop PDB Residue
2apcA01 106 331
2apcA02 367 446

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


Domain ATOM Sequence

>pdb|2apcA01
AVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIAVQPDHRKFQGYY
KIARHYRWALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDF
FPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRKGRACVRPEISRTMTFGRKGVSHGQFFDQHL    

Domain COMBS Sequence

>pdb|2apcA01
AVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQVIASYGSAVTHIRQPDLSNIAVQPDHRKFQGYY
KIARHYRWALGQIFHNFNYPAAVVVEDDLEVAPDFFEYFQATYPLLKADPSLWCVSAWNDNGKEQMVDSSKPELLYRTDF
FPGLGWLLLAELWAELEPKWPKAFWDDWMRRPEQRKGRACVRPEISRTMTFGRKGVSHGQFFDQHL    

Domain History Events (13)

Domain assigned by auto on 02 Nov 2006 03:35

Assigning to "3.90.550.10" based on similarity with "1fo8A01"

Flow stage update by auto on 02 Nov 2006 03:17

No in_process hits for Domain "2apcA01" ready to be processed

Update comment by auto on 01 Nov 2006 21:56

Domain "2apcA01" hits Domain "2am4A01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 18:04

Domain "2apcA01" hits Domain "2am5A01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 14:28

Domain "2apcA01" hits Domain "2am3A01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "2apcA01" hits Domain "2am3A01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:50

Domain "2apcA01" hits Domain "2am3A01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:09

Domain "2apcA01" hits Domain "2am3A01" (100% over 100%) which is currently in process

Flow stage update by auto on 18 Oct 2006 13:31

Domain "2apcA01" hits Domain "2am3A01" (100% over 100%) which is currently in process

Flow stage update by auto on 18 Oct 2006 13:31

NW result present for Domain "2apcA01"

Flow stage update by auto on 16 Oct 2006 16:34

All required files are present for Domain "2apcA01"

Flow stage update by auto on 16 Oct 2006 07:53

Beginning processing for Domain "2apcA01"

Insertion by auto on 16 Oct 2006 07:27

Final ChopClose added based on similarity with "2am3A"