CATH Domain: 2akzA01 XML data for domain: 2akzA01

Molscript image for 2akzA01
2akzA01
PDB coordinates for domain 2akzA01

PDB 2akz, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.10 Enolase-like, N-terminal domain Gene3D
3.30.390.10.3
3.30.390.10.3.1
3.30.390.10.3.1.1
3.30.390.10.3.1.1.1
3.30.390.10.3.1.1.1.1

Segment boundaries for domain 2akzA01

Chopping figure for domain 2akzA01
DomainStart PDB ResidueStop PDB Residue
2akzA01 1 126
2akzA02 127 435

Structural Neighbourhood (24 entries)

There are 24 matching structural neighberhood comparisons for CATH ID 3.30.390.10.3.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 24 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1nu5A01 85.41 Chloromuconate cycloisomerasePseudomonas sp. P51 3.30.390.10 116 12 81 3.01 3.68
3bjsA01 84.92 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 116 15 81 2.99 3.66
1tzzB01 84.66 Bradyrhizobium japonicumBll6730 protein 3.30.390.10 119 13 80 2.76 3.41
2ovlA01 84.60 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.30.390.10 123 8 80 2.66 3.29
3dgbA01 84.08 Muconate cycloisomeraseToluene and xylene degradationMuconate cycloisomerase [EC:5.5.1.1]Benzoate degradation via hydroxylationMetabolic pathways 3.30.390.10 134 12 77 3.08 3.97
1mdlA01 84.06 Mandelate racemasePseudomonas putida 3.30.390.10 126 11 81 2.77 3.39
3go2A01 83.97 Burkholderia xenovorans LB400Putative uncharacterized protein 3.30.390.10 114 14 79 2.96 3.73
2qq6B01 83.88 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.30.390.10 115 9 73 1.78 2.41
1tkkA01 83.71 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.30.390.10 115 15 80 2.72 3.39
2og9A01 83.44 Toluene and xylene degradationPolaromonas sp. JS666Mandelate racemase [EC:5.1.2.2]Mandelate racemase/muconate lactonizing enzymeBenzoate degradation via hydroxylation 3.30.390.10 129 14 79 2.80 3.51
3fv9D01 83.35 Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM 3.30.390.10 130 11 78 2.55 3.25
2oqhB01 82.71 Putative isomeraseStreptomyces coelicolor 3.30.390.10 129 13 72 2.43 3.37
2qjjA01 82.40 Mandelate racemase/muconate lactonizing enzyme, N-terminal domain proteinStarvation sensing protein RspANovosphingobium aromaticivorans DSM 12444 3.30.390.10 140 13 71 2.67 3.74
2pmqA01 82.29 Roseovarius sp. HTCC2601Mandelate racemase/muconate lactonizing enzyme 3.30.390.10 127 11 78 2.80 3.56
1ec7C01 82.28 Ascorbate and aldarate metabolismD-glucarate catabolic processGlucarate dehydratase activityGlucarate dehydrataseGlucarate dehydratase [EC:4.2.1.40] 3.30.390.10 136 6 69 2.40 3.47
1rvkA01 81.68 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 115 10 76 3.10 4.07
2qgyB01 81.20 3.30.390.10 135 5 74 2.75 3.68
1jpdX01 80.67 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.30.390.10 99 12 73 2.94 4.03
2oqyA01 80.61 Muconate cycloisomeraseOceanobacillus iheyensis 3.30.390.10 142 10 74 3.47 4.65
1kkoA01 79.93 3-methylaspartate ammonia-lyaseCitrobacter amalonaticus 3.30.390.10 163 14 68 2.75 4.00
2hzgB01 79.79 Rhodobacter sphaeroides 2.4.1Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily 3.30.390.10 143 4 68 2.59 3.78
2nqlA01 79.03 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.30.390.10 162 11 63 2.72 4.28
2pgeA01 78.94 Ubiquinone and other terpenoid-quinone biosynthesisDesulfotalea psychrophilaRelated to N-acylamino acid racemase (MenC)O-succinylbenzoate synthase [EC:4.2.1.113]Metabolic pathways 3.30.390.10 127 8 81 3.63 4.48
2pgwA01 78.24 Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein 3.30.390.10 147 7 68 3.16 4.65
Displaying entries 1 to 24 (page 1 of 1)


Domain ATOM Sequence

>pdb|2akzA01
SIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHINSTIAPALISSG
LSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERE    

Domain COMBS Sequence

>pdb|2akzA01
SIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHINSTIAPALISSG
LSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERE    

Domain History Events (13)

Domain assigned by auto on 02 Nov 2006 03:35

Assigning to "3.30.390.10" based on similarity with "1te6A01"

Flow stage update by auto on 02 Nov 2006 03:17

No in_process hits for Domain "2akzA01" ready to be processed

Update comment by auto on 01 Nov 2006 21:56

Domain "2akzA01" hits Domain "2akzB01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 18:04

Domain "2akzA01" hits Domain "2akmA01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 14:28

Domain "2akzA01" hits Domain "2akmB01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "2akzA01" hits Domain "2akmB01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:50

Domain "2akzA01" hits Domain "2akmB01" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:09

Domain "2akzA01" hits Domain "2akmB01" (100% over 100%) which is currently in process

Flow stage update by auto on 18 Oct 2006 09:25

Domain "2akzA01" hits Domain "2akmB01" (100% over 100%) which is currently in process

Flow stage update by auto on 18 Oct 2006 09:25

NW result present for Domain "2akzA01"

Flow stage update by auto on 16 Oct 2006 16:34

All required files are present for Domain "2akzA01"

Flow stage update by auto on 16 Oct 2006 07:53

Beginning processing for Domain "2akzA01"

Insertion by auto on 16 Oct 2006 07:27

Final ChopClose added based on similarity with "1te6A"