CATH Domain: 2akzA01

2akzA01

PDB 2akz, Chain A, Domain 1

CATH Code	Level Description	Links
3	Alpha Beta
3.30	2-Layer Sandwich
3.30.390	Enolase-like; domain 1
3.30.390.10	Enolase-like, N-terminal domain	Gene3D
3.30.390.10.3
3.30.390.10.3.1
3.30.390.10.3.1.1
3.30.390.10.3.1.1.1
3.30.390.10.3.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2akzA01

Domain	Start PDB Residue	Stop PDB Residue
2akzA01	1	126
2akzA02	127	435

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (24 entries)

There are 24 matching structural neighberhood comparisons for CATH ID 3.30.390.10.3.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
1nu5A01	85.41	Chloromuconate cycloisomerasePseudomonas sp. P51	3.30.390.10	116	12	81	3.01	3.68
3bjsA01	84.92	Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme	3.30.390.10	116	15	81	2.99	3.66
1tzzB01	84.66	Bradyrhizobium japonicumBll6730 protein	3.30.390.10	119	13	80	2.76	3.41
2ovlA01	84.60	Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase	3.30.390.10	123	8	80	2.66	3.29
3dgbA01	84.08	Muconate cycloisomeraseToluene and xylene degradationMuconate cycloisomerase [EC:5.5.1.1]Benzoate degradation via hydroxylationMetabolic pathways	3.30.390.10	134	12	77	3.08	3.97
1mdlA01	84.06	Mandelate racemasePseudomonas putida	3.30.390.10	126	11	81	2.77	3.39
3go2A01	83.97	Burkholderia xenovorans LB400Putative uncharacterized protein	3.30.390.10	114	14	79	2.96	3.73
2qq6B01	83.88	Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein	3.30.390.10	115	9	73	1.78	2.41
1tkkA01	83.71	Bacillus subtilisL-Ala-D/L-Glu epimerase	3.30.390.10	115	15	80	2.72	3.39
2og9A01	83.44	Toluene and xylene degradationPolaromonas sp. JS666Mandelate racemase [EC:5.1.2.2]Mandelate racemase/muconate lactonizing enzymeBenzoate degradation via hydroxylation	3.30.390.10	129	14	79	2.80	3.51
3fv9D01	83.35	Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM	3.30.390.10	130	11	78	2.55	3.25
2oqhB01	82.71	Putative isomeraseStreptomyces coelicolor	3.30.390.10	129	13	72	2.43	3.37
2qjjA01	82.40	Mandelate racemase/muconate lactonizing enzyme, N-terminal domain proteinStarvation sensing protein RspANovosphingobium aromaticivorans DSM 12444	3.30.390.10	140	13	71	2.67	3.74
2pmqA01	82.29	Roseovarius sp. HTCC2601Mandelate racemase/muconate lactonizing enzyme	3.30.390.10	127	11	78	2.80	3.56
1ec7C01	82.28	Ascorbate and aldarate metabolismD-glucarate catabolic processGlucarate dehydratase activityGlucarate dehydrataseGlucarate dehydratase [EC:4.2.1.40]	3.30.390.10	136	6	69	2.40	3.47
1rvkA01	81.68	Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme	3.30.390.10	115	10	76	3.10	4.07
2qgyB01	81.20		3.30.390.10	135	5	74	2.75	3.68
1jpdX01	80.67	Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12	3.30.390.10	99	12	73	2.94	4.03
2oqyA01	80.61	Muconate cycloisomeraseOceanobacillus iheyensis	3.30.390.10	142	10	74	3.47	4.65
1kkoA01	79.93	3-methylaspartate ammonia-lyaseCitrobacter amalonaticus	3.30.390.10	163	14	68	2.75	4.00
2hzgB01	79.79	Rhodobacter sphaeroides 2.4.1Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily	3.30.390.10	143	4	68	2.59	3.78
2nqlA01	79.03	Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme	3.30.390.10	162	11	63	2.72	4.28
2pgeA01	78.94	Ubiquinone and other terpenoid-quinone biosynthesisDesulfotalea psychrophilaRelated to N-acylamino acid racemase (MenC)O-succinylbenzoate synthase [EC:4.2.1.113]Metabolic pathways	3.30.390.10	127	8	81	3.63	4.48
2pgwA01	78.24	Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein	3.30.390.10	147	7	68	3.16	4.65

[top]
Domain ATOM Sequence

>pdb|2akzA01
SIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHINSTIAPALISSG
LSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERE

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2akzA01
SIEKIWAREILDSRGNPTVEVDLYTAKGLFRAAVPSGASTGIYEALELRDGDKQRYLGKGVLKAVDHINSTIAPALISSG
LSVVEQEKLDNLMLELDGTENKSKFGANAILGVSLAVCKAGAAERE

BLAST against CATH

[top]
Domain History Events (13)

Domain assigned by auto on 02 Nov 2006 03:35

Assigning to "3.30.390.10" based on similarity with "1te6A01"

Flow stage update by auto on 02 Nov 2006 03:17

No in_process hits for Domain "2akzA01" ready to be processed

Update comment by auto on 01 Nov 2006 21:56

Domain "2akzA01" hits Domain "2akzB01" (100% over 100%) which is currently in process