CATH Domain: 2aklA01 XML data for domain: 2aklA01

Molscript image for 2aklA01
2aklA01
PDB coordinates for domain 2aklA01

PDB 2akl, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.20 Single Sheet
2.20.25 N-terminal domain of TfIIb
2.20.25.10 Gene3D
2.20.25.10.21
2.20.25.10.21.1
2.20.25.10.21.1.1
2.20.25.10.21.1.1.1
2.20.25.10.21.1.1.1.1

Segment boundaries for domain 2aklA01

Chopping figure for domain 2aklA01
DomainStart PDB ResidueStop PDB Residue
2aklA01 1 43
2aklA02 44 116

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 2.20.25.10.21.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1irxA02 76.00 Aminoacyl-tRNA biosynthesisLysyl-tRNA synthetase, class I [EC:6.1.1.6]Pyrococcus horikoshiiLysyl-tRNA synthetase 2.30.30.300 43 11 83 3.71 4.43
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|2aklA01
MVSTLPPCPQCNSEYTYEDGALLVCPECAHEWSPNEAATASDD    

Domain COMBS Sequence

>pdb|2aklA01
MVSTLPPCPQCNSEYTYEDGALLVCPECAHEWSPNEAATASDD    

Domain History Events (264)

Domain assigned by cuff on 07 Feb 2008 16:39

enough evidence for homology here

Domain scan prc pfamcath by auto on 25 Sep 2007 12:19

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 20 results for 2aklA01

Homcheck comment by rupa on 11 Sep 2007 14:56

After further review, this still appears to be the most appropriate choice.

Domain assignment manual match h by rupa on 21 Aug 2007 12:10

Very high cathedral and ssap scores, and same folding. Both may be involved in transcription

Homcheck review by rupa on 21 Aug 2007 12:10

Very high cathedral and ssap scores, and same folding. Both may be involved in transcription

Flow stage update by rupa on 21 Aug 2007 12:10

Very high cathedral and ssap scores, and same folding. Both may be involved in transcription

Homcheck allotment by rupa on 21 Aug 2007 12:07

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 21 Aug 2007 12:07

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 21 Aug 2007 12:00

Domain "2aklA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 21 Aug 2007 12:00

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2aklA01

Flow stage update by auto on 21 Aug 2007 11:44

Retrieved PRC_PFAMCATH results for job ID SID7123042855161856 and results inserted.

Update comment by auto on 19 Aug 2007 11:06

PRC_PFAMCATH job SID7123042855161856 is not yet finished.

Prc pfamcath submit by auto on 19 Aug 2007 11:04

The entry "2aklA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 19 Aug 2007 11:04

The entry "2aklA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 19 Aug 2007 08:34

Giving up on PRC_PFAMCATH job SID1981340304370024 because submission time of Fri Aug 17 04:26:22 2007 is more than 172800 seconds older than current time (Sun Aug 19 08:34:55 2007).

Update comment by auto on 17 Aug 2007 04:27

PRC_PFAMCATH job SID1981340304370024 is not yet finished.

Prc pfamcath submit by auto on 17 Aug 2007 04:26

The entry "2aklA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Aug 2007 04:26

The entry "2aklA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 17 Aug 2007 03:04

Retrieved SSAP results for job ID SID7568548240665132 and chopping inserted.

Domain scan ssap cath by auto on 17 Aug 2007 03:03

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 610 results for 2aklA01

Update comment by auto on 16 Aug 2007 23:33

SSAP job SID7568548240665132 is not yet finished.

Flow stage update by auto on 16 Aug 2007 22:29

The entry "2aklA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 16 Aug 2007 22:29

The entry "2aklA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Aug 2007 17:25

Giving up on SSAP job SID9818722776473632 because submission time of Tue Aug 14 08:09:06 2007 is more than 172800 seconds older than current time (Thu Aug 16 17:25:06 2007).

Update comment by auto on 14 Aug 2007 09:46

SSAP job SID9818722776473632 is not yet finished.

Ssap cath submit by auto on 14 Aug 2007 08:09

The entry "2aklA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 08:09

The entry "2aklA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Aug 2007 00:45

Retrieved PRC results for job ID SID4863911343001056 and inserted them into the database.

Domain scan prc cath by auto on 14 Aug 2007 00:44

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2aklA01

Flow stage update by auto on 13 Aug 2007 09:10

The entry "2aklA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 13 Aug 2007 09:10

The entry "2aklA01" has been submitted to the PRC webservice.

Flow stage update by auto on 13 Aug 2007 02:40

Retrieved HMM(SAM) results for job ID SID7139471650283720 and inserted them into the database.

Domain scan sam cath by auto on 13 Aug 2007 02:39

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 2aklA01

Update comment by auto on 12 Aug 2007 12:26

HMM(SAM) job SID7139471650283720 is not yet finished.

Sam cath submit by auto on 12 Aug 2007 06:12

The entry "2aklA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 12 Aug 2007 06:12

The entry "2aklA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 11 Aug 2007 19:30

Retrieved "2aklA01" CATHEDRAL results for job ID SID1814189564988384 and inserted them into the database.

Domain scan cathedral cath by auto on 11 Aug 2007 19:30

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 122 results for 2aklA01

Update comment by auto on 11 Aug 2007 05:05

"2aklA01" CATHEDRAL job SID1814189564988384 is not yet finished.

Cathedral cath submit by auto on 11 Aug 2007 03:18

The entry "2aklA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 03:18

The entry "2aklA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 11 Aug 2007 00:07

ScanList with 9778 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2aklA01.scanlist" for "2aklA01"

Write scan list by auto on 11 Aug 2007 00:07

Writing ScanList containing 9778 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2aklA01.scanlist" for domain "2aklA01"

Update comment by auto on 10 Aug 2007 14:28

Waiting for 984 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 10:27

Waiting for 1052 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 06:40

Waiting for 1095 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 10 Aug 2007 02:40

Waiting for 1146 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 22:27

Waiting for 1198 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 19:07

Waiting for 1261 new domains (example : 1h4uA00) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 14:50

Waiting for 1336 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 10:50

Waiting for 1377 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 06:36

Waiting for 1412 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 09 Aug 2007 02:42

Waiting for 1457 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 22:27

Waiting for 1505 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 18:34

Waiting for 1577 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 14:33

Waiting for 1645 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 10:56

Waiting for 1704 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 06:41

Waiting for 1742 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 08 Aug 2007 02:47

Waiting for 1792 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 22:36

Waiting for 1837 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 19:23

Waiting for 1893 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 15:03

Waiting for 1975 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 10:33

Waiting for 2056 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 06:44

Waiting for 2116 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 07 Aug 2007 02:39

Waiting for 2178 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 22:28

Waiting for 2230 new domains (example : 1t6pF01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 18:42

Waiting for 2293 new domains (example : 1t6pD03) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 14:35

Waiting for 2348 new domains (example : 1rqrB02) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 11:12

Waiting for 2404 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 09:07

Waiting for 2415 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 06 Aug 2007 02:02

Waiting for 2528 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 18:54

Waiting for 2652 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 07:07

Waiting for 2828 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 05 Aug 2007 03:00

Waiting for 2883 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 22:41

Waiting for 2924 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 18:55

Waiting for 2965 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 14:55

Waiting for 3034 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 10:55

Waiting for 3098 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 06:48

Waiting for 3152 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 04 Aug 2007 02:55

Waiting for 3197 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 22:45

Waiting for 3216 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 19:40

Waiting for 3206 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 15:34

Waiting for 3198 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 10:46

Waiting for 3054 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 06:48

Waiting for 3126 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 03 Aug 2007 02:47

Waiting for 3204 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 22:36

Waiting for 3254 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 19:14

Waiting for 3282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 15:06

Waiting for 3339 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 10:48

Waiting for 3395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 06:48

Waiting for 3471 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 02 Aug 2007 02:47

Waiting for 3542 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 22:32

Waiting for 3606 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 19:18

Waiting for 3650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 14:48

Waiting for 3730 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 10:39

Waiting for 3800 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 06:40

Waiting for 3884 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 01 Aug 2007 02:45

Waiting for 3939 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 22:30

Waiting for 3997 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 18:47

Waiting for 4076 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 14:40

Waiting for 4166 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 10:57

Waiting for 4233 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 07:10

Waiting for 4307 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 31 Jul 2007 03:15

Waiting for 4386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 23:17

Waiting for 4468 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 19:40

Waiting for 4553 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 16:10

Waiting for 4605 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 09:50

Waiting for 4715 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jul 2007 02:15

Waiting for 4857 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 11:12

Waiting for 4966 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 07:13

Waiting for 5043 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 03:13

Waiting for 5108 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jul 2007 00:16

Waiting for 5134 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 18:54

Waiting for 5205 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 14:49

Waiting for 5292 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 10:49

Waiting for 5345 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 06:53

Waiting for 5411 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jul 2007 02:58

Waiting for 5495 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 22:36

Waiting for 5546 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 18:53

Waiting for 5622 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 14:46

Waiting for 5708 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 10:42

Waiting for 5804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 06:40

Waiting for 5906 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jul 2007 02:36

Waiting for 5998 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 22:59

Waiting for 6044 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 19:14

Waiting for 6072 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 15:40

Waiting for 6103 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 11:11

Waiting for 6154 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 07:17

Waiting for 6212 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 04:28

Waiting for 6246 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 26 Jul 2007 00:42

Waiting for 6282 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 15:13

Waiting for 6426 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 10:58

Waiting for 6496 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 06:56

Waiting for 6574 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 25 Jul 2007 02:50

Waiting for 6650 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 22:41

Waiting for 6699 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 19:04

Waiting for 6753 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 15:01

Waiting for 6835 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 10:57

Waiting for 6895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 07:00

Waiting for 6969 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 24 Jul 2007 02:56

Waiting for 7030 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 22:58

Waiting for 7071 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 19:08

Waiting for 7125 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 14:59

Waiting for 7201 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 11:08

Waiting for 7252 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 07:15

Waiting for 7314 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 23 Jul 2007 03:26

Waiting for 7358 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 19:27

Waiting for 7386 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 15:22

Waiting for 7410 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 11:19

Waiting for 7442 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 07:16

Waiting for 7493 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Jul 2007 03:35

Waiting for 7532 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 23:19

Waiting for 7562 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 19:14

Waiting for 7594 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 15:20

Waiting for 7635 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 11:22

Waiting for 7684 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 07:17

Waiting for 7732 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Jul 2007 03:39

Waiting for 7778 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 23:16

Waiting for 7804 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 19:49

Waiting for 7838 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 16:39

Waiting for 7895 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 11:10

Waiting for 7954 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 06:59

Waiting for 7989 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 20 Jul 2007 02:57

Waiting for 8046 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 23:05

Waiting for 8061 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 19:30

Waiting for 8094 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 15:32

Waiting for 8122 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 11:17

Waiting for 8167 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 07:06

Waiting for 8211 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 19 Jul 2007 03:18

Waiting for 8242 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 22:48

Waiting for 8273 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 19:04

Waiting for 8325 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 15:00

Waiting for 8374 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 11:14

Waiting for 8395 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 07:11

Waiting for 8394 new domains (example : 1gviA01) to be processed so that they can be scanned against too.

Update comment by auto on 18 Jul 2007 02:39

Waiting for 8379 new domains (example : 1g1yB02) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 21:50

Waiting for 8343 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 15:46

Waiting for 8284 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 10:54

Waiting for 8221 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 07:03

Waiting for 8152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Jul 2007 03:06

Waiting for 8083 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 22:52

Waiting for 8009 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 19:10

Waiting for 7928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 15:27

Waiting for 7841 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 10:51

Waiting for 7749 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 06:35

Waiting for 7631 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 04:39

Waiting for 7496 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Jul 2007 01:11

Waiting for 7325 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 22:49

Waiting for 7146 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 19:32

Waiting for 6928 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 15:24

Waiting for 6694 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 11:50

Waiting for 6438 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 07:19

Waiting for 6152 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Jul 2007 03:24

Waiting for 5796 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 23:12

Waiting for 5384 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 21:14

Waiting for 4906 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 18:05

Waiting for 4380 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 13:00

Waiting for 3708 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Jul 2007 06:08

Waiting for 2933 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Jul 2007 18:58

Waiting for 1961 new domains (example : 1ai6A01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 16:12

Waiting for 1013 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 14:09

Waiting for 1040 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 12:26

Waiting for 1062 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 10:03

Waiting for 1110 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 08:03

Waiting for 1159 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 06:03

Waiting for 1205 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 04:03

Waiting for 1240 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 02:08

Waiting for 1265 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 12 Jul 2007 00:12

Waiting for 1270 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 22:06

Waiting for 1282 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 20:10

Waiting for 1285 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 18:08

Waiting for 1276 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 16:10

Waiting for 1258 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 14:06

Waiting for 1144 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 12:07

Waiting for 1163 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 10:04

Waiting for 1196 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 08:04

Waiting for 1231 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 06:05

Waiting for 1257 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 04:03

Waiting for 1280 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 11 Jul 2007 00:05

Waiting for 1308 new domains (example : 1u0rA01) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 22:01

Waiting for 1315 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 20:01

Waiting for 1304 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 18:04

Waiting for 1290 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 16:04

Waiting for 1275 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 14:05

Waiting for 1248 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 12:07

Waiting for 1207 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 10:11

Waiting for 1071 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 08:11

Waiting for 1065 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 06:10

Waiting for 1055 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 04:11

Waiting for 1045 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 02:22

Waiting for 1027 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 10 Jul 2007 00:34

Waiting for 1000 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 09 Jul 2007 22:22

Waiting for 958 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 09 Jul 2007 19:13

Waiting for 910 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 09 Jul 2007 14:57

Waiting for 810 new domains (example : 1bdg001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 18:05

Waiting for 596 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 16:03

Waiting for 594 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 14:03

Waiting for 592 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 12:02

Waiting for 590 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 10:14

Waiting for 588 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 08:14

Waiting for 583 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 06:16

Waiting for 578 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 04:16

Waiting for 572 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 02:17

Waiting for 564 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 07 Jul 2007 00:17

Waiting for 556 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 22:12

Waiting for 548 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 20:17

Waiting for 536 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 18:18

Waiting for 517 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 16:22

Waiting for 483 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 14:27

Waiting for 439 new domains (example : 1mt2001) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 11:14

Waiting for 101 new domains (example : 2a9vD00) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 10:03

Waiting for 100 new domains (example : 2a9vD00) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 08:37

Waiting for 111 new domains (example : 2a9vD00) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 04:58

Waiting for 188 new domains (example : 2a9vD00) to be processed so that they can be scanned against too.

Update comment by auto on 06 Jul 2007 00:57

Waiting for 268 new domains (example : 2a9vD00) to be processed so that they can be scanned against too.

Update comment by auto on 05 Jul 2007 22:28

Waiting for 290 new domains (example : 2a9vD00) to be processed so that they can be scanned against too.

Update comment by auto on 05 Jul 2007 20:31

Waiting for 311 new domains (example : 2a9vD00) to be processed so that they can be scanned against too.

Update comment by auto on 05 Jul 2007 18:42

Waiting for 324 new domains (example : 2a9vD00) to be processed so that they can be scanned against too.

Flow stage update by auto on 05 Jul 2007 18:41

No satisfactory AssignClose result found.

Flow stage update by auto on 05 Jul 2007 18:38

No in_process hits for Domain "2aklA01" ready to be processed

Flow stage update by auto on 05 Jul 2007 18:38

NW result present for Domain "2aklA01"

Flow stage update by auto on 04 Jul 2007 22:02

All required files are present for Domain "2aklA01"

Flow stage update by auto on 04 Jul 2007 14:59

Beginning processing for Domain "2aklA01"

Insertion by cuff on 04 Jul 2007 13:10

nice chopping to go