CATH Domain: 2airB02 XML data for domain: 2airB02

Molscript image for 2airB02
2airB02
PDB coordinates for domain 2airB02

PDB 2air, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.30 SH3 type barrels.
2.30.30.20 Gene3D
2.30.30.20.1
2.30.30.20.1.1
2.30.30.20.1.1.1
2.30.30.20.1.1.1.1
2.30.30.20.1.1.1.1.1

[top]
Segment boundaries for domain 2airB02

Chopping figure for domain 2airB02
DomainStart PDB ResidueStop PDB Residue
2airB01 8 100
2airB02 101 153

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 2.30.30.20.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ywwB02 88.94 Pyrimidine metabolismMethanocaldococcus jannaschiiAspartate carbamoyltransferase regulatory subunitAlanine, aspartate and glutamate metabolismAspartate carbamoyltransferase regulatory chain 2.30.30.20 51 33 94 1.98 2.10
1l1oC02 79.97 Replication factor A1DNA-dependent DNA replicationDNA replicationNucleotide excision repairReplication protein A 70 kDa DNA-binding subunit 2.20.25.10 38 18 69 2.99 4.28
2rh2A00 78.56 Dihydrofolate reductase type 2Escherichia coli 2.30.30.60 57 0 80 3.93 4.87
2vv5A02 75.07 Escherichia coli O157:H7Small conductance mechanosensitive ion channel, MscS familySmall-conductance mechanosensitive channel 2.30.30.60 50 6 73 3.47 4.72
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2airB02
ERIDNVLVCPNSNCISHAEPVSSSFAVRKRANDIALKCKYCEKEFSHNVVLAN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2airB02
ERIDNVLVCPNSNCISHAEPVSSSFAVRKRANDIALKCKYCEKEFSHNVVLAN
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 21:36

Assigning to "2.30.30.20" based on similarity with "1ezzD02" (NWSI: 100, NWO: 100, SPS: 95.70, SPO: 100, RMSD: 0.56)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "2airB02"

Flow stage update by auto on 28 Apr 2006 17:48

All required files are present for Domain "2airB02"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "2airB02"

Insertion by auto on 15 Mar 2006 02:16

Final ChopClose added based on similarity with "1d09B" [LEE: 0, LME: 0, MR: 0, LG: 2, SS: 89.48, SI: 100, SO: 100]