CATH Domain: 2ad6B00 XML data for domain: 2ad6B00

Molscript image for 2ad6B00
2ad6B00
PDB coordinates for domain 2ad6B00

PDB 2ad6, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.160 Methanol Dehydrogenase; Chain B
4.10.160.10 Methanol Dehydrogenase, chain B Gene3D
4.10.160.10.2
4.10.160.10.2.1
4.10.160.10.2.1.1
4.10.160.10.2.1.1.1
4.10.160.10.2.1.1.1.1

[top]
Segment boundaries for domain 2ad6B00

Chopping figure for domain 2ad6B00
DomainStart PDB ResidueStop PDB Residue
2ad6B00 1 69

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2ad6B00
YDGQNCKEPGNCWENKPGYPEKIAGSKYDPKHDPVELNKQEESIKAMDARNAKRIANAKSSGNFVFDVK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2ad6B00
YDGQNCKEPGNCWENKPGYPEKIAGSKYDPKHDPVELNKQEESIKAMDARNAKRIANAKSSGNFVFDVK
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 08 Dec 2006 21:19

Assigning to "4.10.160.10" based on similarity with "1b2nB00"

Flow stage update by auto on 08 Dec 2006 21:17

No in_process hits for Domain "2ad6B00" ready to be processed

Flow stage update by auto on 08 Dec 2006 21:17

NW result present for Domain "2ad6B00"

Flow stage update by auto on 07 Dec 2006 17:18

All required files are present for Domain "2ad6B00"

Flow stage update by auto on 07 Dec 2006 01:29

Beginning processing for Domain "2ad6B00"

Insertion by auto on 07 Dec 2006 01:26

Final ChopClose added based on similarity with "2ad6D"