CATH Domain: 2absA02 XML data for domain: 2absA02

Molscript image for 2absA02
2absA02
PDB coordinates for domain 2absA02

PDB 2abs, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1110 Adenosine kinase, small domain
3.30.1110.10 Gene3D
3.30.1110.10.1
3.30.1110.10.1.1
3.30.1110.10.1.1.1
3.30.1110.10.1.1.1.1
3.30.1110.10.1.1.1.1.1

[top]
Segment boundaries for domain 2absA02

Chopping figure for domain 2absA02
DomainStart PDB ResidueStop PDB Residue
2absA01 11 21
2absA01 67 124
2absA01 142 356
2absA02 22 66
2absA02 125 141

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.1110.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1bx4A02 93.68 Ribonucleoside monophosphate biosynthetic processHomo sapiensAdenosine kinaseAdenosine kinase activity 3.30.1110.10 63 32 96 0.98 1.01
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2absA02
ILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLGVCAVLINEKERTLCTH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2absA02
ILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLGVCAVLINEKERTLCTH
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 21:31

Assigning to "3.30.1110.10" based on similarity with "1dgmA02" (NWSI: 100, NWO: 100, SPS: 98.02, SPO: 100, RMSD: 0.51)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "2absA02"

Flow stage update by auto on 28 Apr 2006 17:48

All required files are present for Domain "2absA02"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "2absA02"

Insertion by auto on 15 Mar 2006 02:04

Final ChopClose added based on similarity with "1dgmA" [LEE: 0, LME: 0, MR: 4, LG: 4, SS: 95.39, SI: 98.3050847457627, SO: 97.5206611570248]