CATH Domain: 2a8xA03 XML data for domain: 2a8xA03

Molscript image for 2a8xA03
2a8xA03
PDB coordinates for domain 2a8xA03

PDB 2a8x, Chain A, Domain 3

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.390 Enolase-like; domain 1
3.30.390.30 Gene3D
3.30.390.30.7
3.30.390.30.7.1
3.30.390.30.7.1.1
3.30.390.30.7.1.1.1
3.30.390.30.7.1.1.1.1

[top]
Segment boundaries for domain 2a8xA03

Chopping figure for domain 2a8xA03
DomainStart PDB ResidueStop PDB Residue
2a8xA01 2 146
2a8xA01 268 342
2a8xA02 147 267
2a8xA03 343 464

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.390.30.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ebdA03 93.29 Dihydrolipoyl dehydrogenaseGeobacillus stearothermophilus 3.30.390.30 115 38 95 1.04 1.09
1xdiA03 90.38 Citrate cycle (TCA cycle)Valine, leucine and isoleucine degradationPyruvate metabolismGlycine, serine and threonine metabolismMetabolic pathways 3.30.390.30 122 22 94 1.51 1.60
2nvkX03 87.32 Protein homodimerization activityThioredoxin reductase 1, mitochondrialDetermination of adult lifespanThioredoxin-disulfide reductase activityGlutathione-disulfide reductase activity 3.30.390.30 115 20 91 2.02 2.21
1mo9A03 81.88 2-oxopropyl-CoM reductase, carboxylatingXanthobacter autotrophicus Py2 3.30.390.30 153 26 77 3.75 4.82
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2a8xA03
RLPRATFCQPNVASFGLTEQQARNEGYDVVVAKFPFTANAKAHGVGDPSGFVKLVADAKHGELLGGHLVGHDVAELLPEL
TLAQRWDLTASELARNVHTHPTSEALQECFHGLVGHINF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2a8xA03
RXLPRATFCQPNVASFGLTEQQARNEGYDVVVAKFPFTANAKAHGVGDPSGFVKLVADAKHGELLGGHLVGHDVAELLPE
LTLAQRWDLTASELARNVHTHPTXSEALQECFHGLVGHXINF
BLAST against CATH

[top]
Domain History Events (7)

Domain assigned by auto on 14 Aug 2007 23:02

Assigning to "3.30.390.30" based on similarity with "2a8xB03"

Flow stage update by auto on 14 Aug 2007 22:48

No in_process hits for Domain "2a8xA03" ready to be processed

Flow stage update by auto on 20 Jul 2007 23:02

Domain "2a8xA03" hits Domain "2a8xB03" (97.5409836065574% over 100%) which is currently in process

Flow stage update by auto on 20 Jul 2007 23:02

NW result present for Domain "2a8xA03"

Flow stage update by auto on 14 Jul 2007 06:01

All required files are present for Domain "2a8xA03"

Flow stage update by auto on 13 Jul 2007 18:42

Beginning processing for Domain "2a8xA03"

Insertion by auto on 13 Jul 2007 03:41

Final ChopClose added based on similarity with "1ebdA"