CATH Domain: 2a6hC05 XML data for domain: 2a6hC05

Molscript image for 2a6hC05
2a6hC05
PDB coordinates for domain 2a6hC05

PDB 2a6h, Chain C, Domain 5

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.50 OB fold (Dihydrolipoamide Acetyltransferase, E2P)
2.40.50.100 Gene3D
2.40.50.100.10
2.40.50.100.10.1
2.40.50.100.10.1.1
2.40.50.100.10.1.1.1
2.40.50.100.10.1.1.1.1

[top]
Segment boundaries for domain 2a6hC05

Chopping figure for domain 2a6hC05
DomainStart PDB ResidueStop PDB Residue
2a6hC01 2 8
2a6hC01 668 698
2a6hC01 832 1004
2a6hC02 9 143
2a6hC02 324 470
2a6hC02 536 592
2a6hC03 144 323
2a6hC04 471 535
2a6hC05 593 667
2a6hC06 699 831
2a6hC07 1005 1115

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 2.40.50.100.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ghjA00 81.11 Azotobacter vinelandiiDihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex 2.40.50.100 79 14 78 3.73 4.75
1hczA02 80.24 Brassica rapa subsp. rapaApocytochrome f 2.40.50.100 59 11 68 2.67 3.93
2awnB02 77.53 ABC transportersMaltooligosaccharide-importing ATPase activityMaltose/maltodextrin import ATP-binding protein MalKMaltose transportMaltose/maltodextrin transport system ATP-binding protein [EC:3.6.3.19] 2.40.50.100 66 12 64 3.00 4.69
1g29102 75.70 Maltose transport protein MalKThermococcus litoralis 2.40.50.140 45 17 54 2.21 4.04
1oxxK02 74.70 ABC transporter, ATP binding protein (Glucose)Glucose/arabinose transport system ATP-binding proteinSulfolobus solfataricusABC transporters 2.40.50.140 45 15 53 2.03 3.81
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2a6hC05
AALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPASENGFLA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2a6hC05
AALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQRPRVVVGQRVRKGDLLADGPASENGFLA
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 21:28

Assigning to "2.40.50.100" based on similarity with "1iw7M05" (NWSI: 100, NWO: 100, SPS: 98.62, SPO: 100, RMSD: 0.18)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "2a6hC05"

Flow stage update by auto on 28 Apr 2006 17:48

All required files are present for Domain "2a6hC05"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "2a6hC05"

Insertion by auto on 10 Mar 2006 15:21

Final ChopClose added based on similarity with "1iw7M" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 92.69, SI: 100, SO: 100]