Domain assigned by auto on 05 Nov 2006 09:28
Assigning to "3.30.50.10" based on similarity with "1lo1A00"
There are 1 matching structural neighberhood comparisons for CATH ID 3.30.50.10.6.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
1kb2B00 | 90.16 | 3.30.50.10 | 85 | 36 | 89 | 4.00 | 4.47 |
>pdb|2a66A00 ELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRG GRNKFGPMYKRDRAL
Assigning to "3.30.50.10" based on similarity with "1lo1A00"
No in_process hits for Domain "2a66A00" ready to be processed
NW result present for Domain "2a66A00"
All required files are present for Domain "2a66A00"
Beginning processing for Domain "2a66A00"
good set of choppings