CATH Domain: 2a4xA00 XML data for domain: 2a4xA00

Molscript image for 2a4xA00
2a4xA00
PDB coordinates for domain 2a4xA00

PDB 2a4x, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.180 2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1
3.10.180.10 2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 Gene3D
3.10.180.10.4
3.10.180.10.4.1
3.10.180.10.4.1.1
3.10.180.10.4.1.1.1
3.10.180.10.4.1.1.1.1

Segment boundaries for domain 2a4xA00

Chopping figure for domain 2a4xA00
DomainStart PDB ResidueStop PDB Residue
2a4xA00 2 132

Structural Neighbourhood (14 entries)

There are 14 matching structural neighberhood comparisons for CATH ID 3.10.180.10.4.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 14 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2rbbA00 87.84 Burkholderia phytofirmans PsJNGlyoxalase/bleomycin resistance protein/dioxygenase 3.10.180.10 126 18 95 2.64 2.77
1f9zA00 85.35 Pyruvate metabolismLactoylglutathione lyase activityNickel ion bindingMethylglyoxal catabolic process to D-lactateLactoylglutathione lyase [EC:4.4.1.5] 3.10.180.10 128 15 90 4.06 4.47
3ct8A00 84.83 BH2160 proteinBacillus halodurans 3.10.180.10 131 13 90 3.58 3.94
2rk0A01 83.27 Glyoxalase/bleomycin resistance protein/dioxygenaseFrankia sp. EAN1pec 3.10.180.10 119 13 87 3.90 4.48
3huhA01 82.67 Virulence protein STM3117Salmonella enterica subsp. enterica serovar Typhimurium 3.10.180.10 119 15 87 3.73 4.29
3ghjA00 82.64 Uncultured bacteriumPutative integron gene cassette protein 3.10.180.10 114 18 86 4.01 4.65
2p7oA00 82.39 Listeria monocytogenes serotype 4b str. F2365Glyoxalase family protein 3.10.180.10 127 16 90 4.29 4.76
2i7rA00 82.11 Conserved domain proteinStreptococcus pneumoniae 3.10.180.10 112 16 85 2.96 3.46
1ss4A00 82.01 Glyoxalase family proteinBacillus cereus ATCC 14579 3.10.180.10 143 14 83 3.59 4.28
2qntA01 81.75 Agrobacterium tumefaciens str. C58Putative uncharacterized protein 3.10.180.10 109 20 83 3.09 3.71
2qqzA01 81.48 Bacillus anthracisGlyoxalase family protein 3.10.180.10 113 16 81 3.96 4.85
2p25A01 81.24 Glyoxylase I family proteinGlyoxylase family proteinEnterococcus faecalis 3.10.180.10 118 18 83 3.72 4.47
1ecsA00 81.22 Klebsiella pneumoniaeBleomycin resistance protein 3.10.180.10 120 16 86 4.01 4.65
1u6lA01 76.97 Pseudomonas aeruginosaPhnB proteinPutative uncharacterized protein 3.10.180.10 120 10 80 3.44 4.29
Displaying entries 1 to 14 (page 1 of 1)


Domain ATOM Sequence

>pdb|2a4xA00
SARISLFAVVVEDMAKSLEFYRKLGVEIPAEADSAPHTEAVLDGGIRLAWDTVETVRSYDPEWQAPTGGHRFAIAFEFPD
TASVDKKYAELVDAGYEGHLKPWNAVWGQRYAIVKDPDGNVVDLFAPLPLE    

Domain COMBS Sequence

>pdb|2a4xA00
MSARISLFAVVVEDMAKSLEFYRKLGVEIPAEADSAPHTEAVLDGGIRLAWDTVETVRSYDPEWQAPTGGHRFAIAFEFP
DTASVDKKYAELVDAGYEGHLKPWNAVWGQRYAIVKDPDGNVVDLFAPLPLEHHHHHH    

Domain History Events (13)

Domain assigned by auto on 02 Nov 2006 03:34

Assigning to "3.10.180.10" based on similarity with "2a4wA00"

Flow stage update by auto on 02 Nov 2006 03:17

No in_process hits for Domain "2a4xA00" ready to be processed

Update comment by auto on 01 Nov 2006 21:56

Domain "2a4xA00" hits Domain "2a4wA00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 18:04

Domain "2a4xA00" hits Domain "2a4wB00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 14:28

Domain "2a4xA00" hits Domain "2a4xB00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "2a4xA00" hits Domain "2a4xB00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:50

Domain "2a4xA00" hits Domain "2a4xB00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:09

Domain "2a4xA00" hits Domain "2a4xB00" (100% over 100%) which is currently in process

Flow stage update by auto on 18 Oct 2006 09:25

Domain "2a4xA00" hits Domain "2a4xB00" (100% over 100%) which is currently in process

Flow stage update by auto on 18 Oct 2006 09:25

NW result present for Domain "2a4xA00"

Flow stage update by auto on 16 Oct 2006 16:34

All required files are present for Domain "2a4xA00"

Flow stage update by auto on 16 Oct 2006 03:13

Beginning processing for Domain "2a4xA00"

Insertion by auto on 15 Oct 2006 23:06

Final ChopClose added based on similarity with "1kllA"