CATH Domain: 2a2rA01 XML data for domain: 2a2rA01

Molscript image for 2a2rA01
2a2rA01
PDB coordinates for domain 2a2rA01

PDB 2a2r, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.30 Glutaredoxin
3.40.30.10 Glutaredoxin Gene3D
3.40.30.10.26
3.40.30.10.26.1
3.40.30.10.26.1.1
3.40.30.10.26.1.1.1
3.40.30.10.26.1.1.1.1

[top]
Segment boundaries for domain 2a2rA01

Chopping figure for domain 2a2rA01
DomainStart PDB ResidueStop PDB Residue
2a2rA01 0 78
2a2rA01 187 208
2a2rA02 79 186

Structural Neighbourhood (15 entries)

There are 15 matching structural neighberhood comparisons for CATH ID 3.40.30.10.26.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 15 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tu7A01 92.58 Onchocerca volvulusGlutathione S-transferase 2 3.40.30.10 99 37 97 1.66 1.71
2gsqA01 90.73 Ommastrephes sloaniGlutathione S-transferase 3.40.30.10 94 34 90 1.53 1.70
2cvdA01 89.38 Prostaglandin-D synthase activityArachidonic acid metabolismProstaglandin-H2 D-isomerase [EC:5.3.99.2]Metabolic pathwaysCytoplasm 3.40.30.10 90 24 89 2.25 2.52
1oktA01 87.02 Glutathione S-transferase [EC:2.5.1.18]Metabolism of xenobiotics by cytochrome P450Glutathione S-transferaseGlutathione metabolismPlasmodium falciparum 3.40.30.10 85 22 78 2.17 2.77
2wb9A01 86.75 Fasciola hepaticaGlutathione transferase sigma class 3.40.30.10 82 23 75 1.43 1.90
2c3nA01 84.58 Soluble fractionGlutathione S-transferase theta-1Glutathione metabolic processGlutathione transferase activityGlutathione metabolism 3.40.30.10 79 17 76 2.42 3.17
2pvqA01 83.93 Glutathione S-transferaseOchrobactrum anthropi 3.40.30.10 95 15 87 3.02 3.47
1k0dB01 83.78 Soluble fractionCytosolProtein URE2Cytoplasmic sequestering of transcription factorProtein urmylation 3.40.30.10 97 12 78 3.70 4.73
3ergA01 82.92 Glutathione S-transferase 2Glutathione metabolic processSaccharomyces cerevisiaeGlutathione transferase activityMitochondrion 3.40.30.10 90 13 84 3.62 4.30
2cz2A01 82.29 Tyrosine metabolismGlutathione transferase activityGlutathione metabolismMetabolic pathwaysGlutathione S-transferase [EC:2.5.1.18] 3.40.30.10 76 15 71 2.12 2.97
3f6fA01 82.14 Glutathione S-transferase [EC:2.5.1.18]Drug metabolism - cytochrome P450Metabolism of xenobiotics by cytochrome P450Glutathione S transferase D10Glutathione transferase activity 3.40.30.10 78 16 72 2.07 2.86
1egoA00 79.95 Glutaredoxin 1Glutaredoxin-1Protein bindingEscherichia coli K-12 3.40.30.10 85 7 73 2.68 3.66
3lgcA00 79.90 Francisella tularensis subsp. tularensisGlutaredoxin 1Glutaredoxin 1 3.40.30.10 86 5 77 3.22 4.17
1abaA00 79.13 Enterobacteria phage T4Glutaredoxin 3.40.30.10 87 9 71 3.08 4.32
1nm3A02 78.41 Peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC:1.11.1.15]Haemophilus influenzaeHybrid peroxiredoxin hyPrx5 3.40.30.10 70 20 69 2.68 3.87
[1]
Displaying entries 1 to 15 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2a2rA01
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLP
KLKAFLASPEYVNLPINGNGK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2a2rA01
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLP
KLKAFLASPEYVNLPINGNGK
BLAST against CATH

[top]
Domain History Events (19)

Domain assigned by auto on 03 Nov 2006 02:21

Assigning to "3.40.30.10" based on similarity with "2a2rB01"

Flow stage update by auto on 03 Nov 2006 02:17

No in_process hits for Domain "2a2rA01" ready to be processed

Update comment by auto on 02 Nov 2006 22:11

Domain "2a2rA01" hits Domain "2a2sA01" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 18:14

Domain "2a2rA01" hits Domain "2a2sB01" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 14:25

Domain "2a2rA01" hits Domain "2a2rB01" (100% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 10:06

Domain "2a2rA01" hits Domain "1tu7A01" (38.3838383838384% over 97.029702970297%) which is currently in process

Update comment by auto on 02 Nov 2006 06:12

Domain "2a2rA01" hits Domain "1tu8D01" (38.3838383838384% over 97.029702970297%) which is currently in process

Update comment by auto on 02 Nov 2006 03:17

Domain "2a2rA01" hits Domain "1tu8B01" (38.3838383838384% over 97.029702970297%) which is currently in process

Update comment by auto on 01 Nov 2006 21:56

Domain "2a2rA01" hits Domain "1tu8A01" (38.3838383838384% over 97.029702970297%) which is currently in process

Update comment by auto on 01 Nov 2006 18:04

Domain "2a2rA01" hits Domain "1tu8C01" (38.3838383838384% over 97.029702970297%) which is currently in process

Update comment by auto on 01 Nov 2006 14:27

Domain "2a2rA01" hits Domain "1tu7B01" (38.3838383838384% over 97.029702970297%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "2a2rA01" hits Domain "1tu7B01" (38.3838383838384% over 97.029702970297%) which is currently in process

Update comment by auto on 01 Nov 2006 05:50

Domain "2a2rA01" hits Domain "1tu7B01" (38.3838383838384% over 97.029702970297%) which is currently in process

Update comment by auto on 01 Nov 2006 02:09

Domain "2a2rA01" hits Domain "1tu7B01" (38.3838383838384% over 97.029702970297%) which is currently in process

Flow stage update by auto on 31 Oct 2006 09:49

Domain "2a2rA01" hits Domain "1tu7B01" (38.3838383838384% over 97.029702970297%) which is currently in process

Flow stage update by auto on 31 Oct 2006 09:48

NW result present for Domain "2a2rA01"

Flow stage update by auto on 28 Oct 2006 01:49

All required files are present for Domain "2a2rA01"

Flow stage update by auto on 27 Oct 2006 05:42

Beginning processing for Domain "2a2rA01"

Insertion by auto on 27 Oct 2006 05:19

Final ChopClose added based on similarity with "11gsA"