CATH Domain: 2a2kA00 XML data for domain: 2a2kA00

Molscript image for 2a2kA00
2a2kA00
PDB coordinates for domain 2a2kA00

PDB 2a2k, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.250 Oxidized Rhodanese; domain 1
3.40.250.10 Oxidized Rhodanese, domain 1 Gene3D
3.40.250.10.10
3.40.250.10.10.1
3.40.250.10.10.1.1
3.40.250.10.10.1.1.1
3.40.250.10.10.1.1.1.1

Segment boundaries for domain 2a2kA00

Chopping figure for domain 2a2kA00
DomainStart PDB ResidueStop PDB Residue
2a2kA00 376 550

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.250.10.10.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1e0cA02 78.53 Azotobacter vinelandiiThiosulfate sulfurtransferaseThiosulfate sulfurtransferase [EC:2.8.1.1] 3.40.250.10 126 19 59 2.98 5.00
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|2a2kA00
MELIGDYSKAFLLQTVDGKHQDLKYISPETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLK
SPIAPKRVILIFHSEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMNHEAFKDE
LKTFRLKTRSW    

Domain COMBS Sequence

>pdb|2a2kA00
MELIGDYSKAFLLQTVDGKHQDLKYISPETMVALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLK
SPIAPCSLDKRVILIFHSEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQDYRPMNHEA
FKDELKTFRLKTRSW    

Domain History Events (15)

Domain assigned by auto on 02 Nov 2006 10:12

Assigning to "3.40.250.10" based on similarity with "1ym9A00"

Flow stage update by auto on 02 Nov 2006 10:06

No in_process hits for Domain "2a2kA00" ready to be processed

Update comment by auto on 02 Nov 2006 06:12

Domain "2a2kA00" hits Domain "1ys0A00" (99.4285714285714% over 100%) which is currently in process

Update comment by auto on 02 Nov 2006 03:17

Domain "2a2kA00" hits Domain "1ymkA00" (99.4285714285714% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 21:56

Domain "2a2kA00" hits Domain "1ymlA00" (99.4285714285714% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 18:04

Domain "2a2kA00" hits Domain "1ym9A00" (99.4285714285714% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 14:27

Domain "2a2kA00" hits Domain "1ymdA00" (99.4285714285714% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "2a2kA00" hits Domain "1ymdA00" (99.4285714285714% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:50

Domain "2a2kA00" hits Domain "1ymdA00" (99.4285714285714% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:09

Domain "2a2kA00" hits Domain "1ymdA00" (99.4285714285714% over 100%) which is currently in process

Flow stage update by auto on 18 Oct 2006 09:25

Domain "2a2kA00" hits Domain "1ymdA00" (99.4285714285714% over 100%) which is currently in process

Flow stage update by auto on 18 Oct 2006 09:25

NW result present for Domain "2a2kA00"

Flow stage update by auto on 16 Oct 2006 16:34

All required files are present for Domain "2a2kA00"

Flow stage update by auto on 16 Oct 2006 03:13

Beginning processing for Domain "2a2kA00"

Insertion by auto on 15 Oct 2006 23:05

Final ChopClose added based on similarity with "1ym9A"