CATH Domain: 2a2aB01 XML data for domain: 2a2aB01

Molscript image for 2a2aB01
2a2aB01
PDB coordinates for domain 2a2aB01

PDB 2a2a, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.200 Phosphorylase Kinase; domain 1
3.30.200.20 Phosphorylase Kinase; domain 1 Gene3D
3.30.200.20.2
3.30.200.20.2.1
3.30.200.20.2.1.2
3.30.200.20.2.1.2.1
3.30.200.20.2.1.2.1.1

[top]
Segment boundaries for domain 2a2aB01

Chopping figure for domain 2a2aB01
DomainStart PDB ResidueStop PDB Residue
2a2aB01 2 97
2a2aB02 98 304

Structural Neighbourhood (80 entries)

There are 80 matching structural neighberhood comparisons for CATH ID 3.30.200.20.2.1.2.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 80 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1uu3A02 91.04 PPAR signaling pathway3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]Peptidyl-threonine phosphorylationAldosterone-regulated sodium reabsorptionNon-small cell lung cancer 3.30.200.20 93 21 94 2.14 2.26
3c0iA01 90.90 Actin cytoskeletonGuanylate kinase activityPeripheral plasma membrane protein CASKCell adhesionHomo sapiens 3.30.200.20 88 32 95 2.26 2.36
3f3zA01 90.44 Cryptosporidium parvum Iowa IICalcium-dependent protein kinase [EC:2.7.11.1]Calcium/calmodulin-dependent protein kinase with a kinase domain and 4 calmodulin like EF hands 3.30.200.20 81 34 89 1.44 1.62
1tkiA01 90.36 Structural constituent of muscleCalcium ion bindingSarcomere organizationTelethonin bindingActin filament binding 3.30.200.20 84 33 91 1.79 1.96
2acxA02 90.23 G protein-coupled receptor kinase 6Homo sapiensRegulation of G-protein coupled receptor protein signaling pathway 3.30.200.20 91 28 96 2.17 2.24
2jamA01 90.02 Calcium/calmodulin-dependent protein kinase type 1GHomo sapiensCalcium/calmodulin-dependent protein kinase I [EC:2.7.11.17] 3.30.200.20 75 37 82 1.23 1.49
2rkuA01 89.98 Polo-like kinase 1 [EC:2.7.11.21]Polo kinase kinase activityProgesterone-mediated oocyte maturationCell proliferationOocyte meiosis 3.30.200.20 89 26 94 2.59 2.74
2wtjA01 89.79 DNA damage response, signal transduction resulting in induction of apoptosisSenescenceSerine/threonine-protein kinase Chk2PML bodyProtein binding 3.30.200.20 79 31 80 1.20 1.50
2j51A01 89.72 CytoplasmOocyte meiosisSTE20-like serine/threonine-protein kinasePlasma membraneHomo sapiens 3.30.200.20 90 27 90 1.70 1.89
3d5vA01 89.54 Danio rerioPolo-like kinase 3.30.200.20 92 24 90 1.95 2.16
1ia8A01 89.22 SenescenceReciprocal meiotic recombinationSerine/threonine-protein kinase Chk1Regulation of cyclin-dependent protein kinase activityProtein binding 3.30.200.20 93 21 89 2.75 3.08
3bqcA02 88.86 Protein N-terminus bindingCasein kinase II subunit alphaSin3 complexCasein kinase 2, alpha polypeptide [EC:2.7.11.1]Plasma membrane 3.30.200.20 91 23 86 1.97 2.27
2weiA01 88.69 Cryptosporidium parvum Iowa IICalmodulin-domain protein kinase 1, putative 3.30.200.20 90 33 92 2.28 2.47
1x8bA01 88.69 Homo sapiensWee1-like protein kinaseProtein binding 3.30.200.20 84 22 89 2.11 2.37
2vgpB01 88.66 Serine/threonine-protein kinase 12-AHistone H3-S10 phosphorylationChromosome, centromeric regionProtein bindingChromatin 3.30.200.20 89 25 96 2.62 2.71
3comB01 88.51 Transcription factor bindingPathways in cancerNon-small cell lung cancerCytoplasmSerine/threonine-protein kinase 4 3.30.200.20 85 24 83 1.49 1.78
2zv2A01 88.46 Calcium ion bindingRegulation of protein kinase activityPositive regulation of transcriptionMAPKKK cascadeCytoplasm 3.30.200.20 77 31 82 1.77 2.15
1xwsA01 88.34 Transcription factor bindingPositive regulation of cyclin-dependent protein kinase activity involved in G1/SManganese ion bindingNegative regulation of apoptosisProtein binding 3.30.200.20 92 28 90 2.02 2.24
3fhrA01 88.32 Response to stressMAP kinase kinase activityNucleusMitogen-activated protein kinase-activated protein kinase 3 [EC:2.7.11.1]MAPK signaling pathway 3.30.200.20 80 25 83 2.20 2.63
2i6lA01 88.32 Protein phosphorylationMitogen-activated protein kinase 6Homo sapiensSignal transductionMitogen-activated protein kinase 4/6 [EC:2.7.11.24] 3.30.200.20 91 17 86 2.17 2.50
2wtkC01 88.27 NucleusSerine/threonine-protein kinase 11Cell cycle arrestProtein bindingSerine/threonine-protein kinase 11 [EC:2.7.11.9] 3.30.200.20 89 25 93 3.58 3.83
2ac3A01 88.19 MAP kinase-interacting serine/threonine-protein kinase 2ATP bindingProtein phosphorylationHomo sapiensProtein serine/threonine kinase activity 3.30.200.20 80 32 85 1.49 1.74
2h6dA01 87.90 Insulin signaling pathwayHypertrophic cardiomyopathy (HCM)Adipocytokine signaling pathwayRegulation of autophagyMTOR signaling pathway 3.30.200.20 86 29 93 2.68 2.87
1u5qA01 87.83 Rattus norvegicusThousand and one amino acid protein kinase [EC:2.7.11.1]Serine/threonine-protein kinase TAO2MAPK signaling pathway 3.30.200.20 96 21 88 2.02 2.28
2clqA01 87.53 Induction of apoptosis by extracellular signalsProtein homodimerization activityMitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]Neurotrophin signaling pathwayATP binding 3.30.200.20 85 21 85 2.17 2.53
3eqrB01 87.48 Activated CDC42 kinase 1GTPase inhibitor activitySmall GTPase mediated signal transductionHomo sapiensPositive regulation of peptidyl-tyrosine phosphorylation 3.30.200.20 91 23 92 2.57 2.78
3blhA01 87.45 Transcription elongation from RNA polymerase II promoterCyclin-dependent protein kinase activityRNA polymerase II carboxy-terminal domain kinase activityProtein bindingCell proliferation 3.30.200.20 86 25 86 2.04 2.35
1kobA01 87.08 Aplysia californicaTwitchin-like protein 3.30.200.20 109 40 77 1.62 2.10
1zy4A01 87.07 Eukaryotic translation initiation factor 2alpha kinase activityProtein bindingSerine/threonine-protein kinase GCN2DNA damage checkpointRegulation of translational initiation 3.30.200.20 94 19 89 1.94 2.17
1wakA01 87.07 Regulation of mRNA processingRNA splicingSerine/threonine-protein kinase SRPK1NucleusProtein binding 3.30.200.20 92 16 84 2.31 2.72
1q5kA01 87.02 Hedgehog signaling pathwayNeurotrophin signaling pathwayAlzheimer's diseaseT cell receptor signaling pathwayER overload response 3.30.200.20 95 19 84 2.87 3.41
1z57A01 87.01 Homo sapiensProtein serine/threonine kinase activityNon-membrane spanning protein tyrosine kinase activityDual specificity protein kinase CLK1Cell proliferation 3.30.200.20 94 21 86 2.46 2.85
2dylA01 86.97 Mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]MAP kinase kinase activityNeurotrophin signaling pathwayStress-activated MAPK cascadeT cell receptor signaling pathway 3.30.200.20 91 18 83 2.79 3.34
3k3iA01 86.76 Cellular component movementMAP kinase kinase activityProtein bindingChemotaxisMitogen-activated protein kinase 14 3.30.200.20 92 27 92 2.43 2.63
2a19C01 86.72 Eukaryotic translation initiation factor 2alpha kinase activityProtein phosphatase type 2A regulator activityInterferon-induced, double-stranded RNA-activated protein kinaseProtein bindingNegative regulation of osteoblast proliferation 3.30.200.20 95 21 85 1.53 1.79
1o6lA02 86.68 Jak-STAT signaling pathwayRAC-beta serine/threonine-protein kinaseNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathway 3.30.200.20 117 24 75 2.08 2.77
2j0iA01 86.34 Cellular component movementT cell receptor signaling pathwaySignal transductionProtein bindingRenal cell carcinoma 3.30.200.20 98 23 83 1.96 2.34
2r3iA01 86.29 Progesterone-mediated oocyte maturationPathways in cancerSmall cell lung cancerOocyte meiosisProstate cancer 3.30.200.20 76 34 83 2.17 2.60
1xbbA01 86.18 T cell receptor complexTyrosine-protein kinase SYKOrgan morphogenesisLeukocyte cell-cell adhesionCell proliferation 3.30.200.20 83 20 85 2.29 2.67
1opjA01 86.18 Protein domain specific bindingNucleusPeptidyl-tyrosine phosphorylationManganese ion bindingMus musculus 3.30.200.20 94 24 86 3.16 3.67
3f61A01 86.15 Serine/threonine-protein kinase pknBSerine/threonine protein kinase, bacterial [EC:2.7.11.1]Mycobacterium tuberculosis 3.30.200.20 91 17 87 2.63 2.99
3e64A01 86.14 Jak-STAT signaling pathwayCellular component movementTyrosine-protein kinase JAK2Chemokine signaling pathwayAdipocytokine signaling pathway 3.30.200.20 93 27 88 2.42 2.74
2evaA01 86.05 Positive regulation of T cell cytokine productionActivation of NF-kappaB-inducing kinase activityPositive regulation of interleukin-2 productionMitogen-activated protein kinase kinase kinase 7Protein binding 3.30.200.20 82 25 85 2.34 2.73
1fmkA03 86.03 Epithelial cell signaling in Helicobacter pylori infectionPositive regulation of integrin activationRegulation of bone resorptionProto-oncogene tyrosine-protein kinase SrcErbB signaling pathway 3.30.200.20 86 18 90 2.33 2.59
3hmmA01 85.98 Type II transforming growth factor beta receptor bindingPeptidyl-threonine phosphorylationPositive regulation of cellular component movementPathway-restricted SMAD protein phosphorylationResponse to cholesterol 3.30.200.20 84 19 85 2.10 2.45
1qpcA01 85.81 Pericentriolar materialPhosphoinositide 3-kinase bindingCD8 receptor bindingT cell receptor signaling pathwayCD4 receptor binding 3.30.200.20 88 21 86 2.15 2.48
1s9jA01 85.76 Prion diseasesNeurotrophin signaling pathwayNon-small cell lung cancerT cell receptor signaling pathwayErbB signaling pathway 3.30.200.20 86 26 92 3.19 3.46
3fpqA01 85.74 Rattus norvegicusSerine/threonine-protein kinase WNK1Protein bindingPotassium channel inhibitor activityATP binding 3.30.200.20 91 23 86 2.53 2.91
1t46A01 85.69 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Protein bindingAcute myeloid leukemia 3.30.200.20 96 19 86 2.75 3.18
3bu3A01 85.41 Insulin receptorInsulin receptor complexPositive regulation of nitric oxide biosynthetic processPhosphoinositide 3-kinase bindingPositive regulation of respiratory burst 3.30.200.20 92 19 90 2.96 3.28
1ob3A01 85.37 Cyclin-dependent kinase [EC:2.7.11.22]Cell division control protein 2 homologPlasmodium falciparum K1 3.30.200.20 83 30 91 3.12 3.42
3f66B01 85.19 Hepatocyte growth factor receptor activityBasal plasma membranePathways in cancerEpithelial cell signaling in Helicobacter pylori infectionProto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1] 3.30.200.20 85 18 81 2.28 2.80
2oibA01 85.05 Chagas diseaseNeurotrophin signaling pathwayInterleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]ApoptosisHomo sapiens 3.30.200.20 93 15 77 2.42 3.13
2izrA01 84.99 Casein kinase I isoform gamma-3Homo sapiensSignal transduction 3.30.200.20 83 13 87 2.75 3.13
1rdqE02 84.99 Calcium signaling pathwayPrion diseasesProtein kinase A [EC:2.7.11.11]Olfactory transductionMesoderm formation 3.30.200.20 124 25 70 2.23 3.14
3cc6A01 84.88 Calcium signaling pathwayChemokine signaling pathwayPositive regulation of cell proliferationProtein-tyrosine kinase 2-betaLeukocyte transendothelial migration 3.30.200.20 90 22 87 2.41 2.74
3c4cA01 84.81 Neurotrophin signaling pathwayNon-small cell lung cancerCytoplasmErbB signaling pathwayProtein phosphorylation 3.30.200.20 86 17 90 3.21 3.56
3bceA01 84.72 Receptor tyrosine-protein kinase erbB-4Transmembrane receptor protein tyrosine kinase activityHomo sapiensBasolateral plasma membraneProtein binding 3.30.200.20 94 18 85 2.35 2.76
2rgpA01 84.67 Calcium signaling pathwayPositive regulation of nitric oxide biosynthetic processEpidermal growth factor receptor activityResponse to UV-APositive regulation of cyclin-dependent protein kinase activity involved in G1/S 3.30.200.20 82 23 84 2.74 3.24
1lufA01 84.59 Muscle, skeletal receptor tyrosine protein kinaseReceptor clusteringRattus norvegicusResponse to muscle activityMemory 3.30.200.20 97 19 84 2.29 2.71
3g51A01 84.25 Progesterone-mediated oocyte maturationNeurotrophin signaling pathwayOocyte meiosisMAPK signaling pathwayLong-term potentiation 3.30.200.20 95 23 78 3.02 3.83
2qkwB01 84.21 Solanum pimpinellifoliumProtein kinaseProtein binding 3.30.200.20 72 25 79 2.04 2.58
2b1pA01 83.77 MAP kinase kinase activityMitogen-activated protein kinase 10Homo sapiensProtein binding 3.30.200.20 101 23 83 2.64 3.17
2jedB01 83.45 Protein kinase C theta typeProtein bindingT cell receptor signaling pathwayNovel protein kinase C [EC:2.7.11.13]Adipocytokine signaling pathway 3.30.200.20 125 20 70 2.33 3.31
3a8xB01 83.40 Tight junctionInsulin signaling pathwayEndocytosisVesicle-mediated transportProtein binding 3.30.200.20 130 24 64 1.65 2.55
1fvrA01 83.28 Cell surfaceMicrovillusTransmembrane receptor protein tyrosine kinase signaling pathwayProtein bindingSignal transduction 3.30.200.20 86 22 85 3.04 3.55
2f57B01 83.24 T cell receptor signaling pathwayP21-activated kinase 7 [EC:2.7.11.1]Protein bindingRenal cell carcinomaErbB signaling pathway 3.30.200.20 106 23 74 2.20 2.95
2w5aA01 83.23 NIMA (never in mitosis gene a)-related kinase [EC:2.7.11.1]Regulation of mitosisSerine/threonine-protein kinase Nek2CentrosomeCentrosome separation 3.30.200.20 64 17 68 1.72 2.52
1ckiA01 81.64 SpindleRattus norvegicusHedgehog signaling pathwaySoluble fractionCircadian rhythm - mammal 3.30.200.20 64 20 69 2.28 3.29
3h9rA01 81.55 Positive regulation of osteoblast differentiationBMP signaling pathwayActivin bindingNegative regulation of apoptosisNegative regulation of activin receptor signaling pathway 3.30.200.20 113 16 69 2.41 3.45
2oo8X01 80.99 Cell surfaceMicrovillusTransmembrane receptor protein tyrosine kinase signaling pathwayProtein bindingSignal transduction 3.30.200.20 60 28 64 2.10 3.24
2q83B01 80.94 Bacillus subtilisSpore coat protein ISpore coat protein I 3.30.200.20 97 9 74 2.65 3.57
2bkkA01 80.79 Aminoglycoside 3'-phosphotransferaseAminoglycoside 3'-phosphotransferase [EC:2.7.1.95]Enterococcus faecalis 3.30.200.20 90 11 84 2.91 3.44
1nd4A01 80.66 Aminoglycoside 3'-phosphotransferaseKlebsiella pneumoniae 3.30.200.20 86 10 84 3.54 4.18
2ppqA01 79.96 Glycine, serine and threonine metabolismMetabolic pathwaysAgrobacterium tumefaciens str. C58Homoserine kinaseHomoserine kinase type II [EC:2.7.1.39] 3.30.200.20 93 4 77 2.84 3.67
3g0eA01 79.42 Pathways in cancerHematopoietic cell lineageProto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]Protein bindingAcute myeloid leukemia 3.30.200.20 131 19 63 2.74 4.32
2jiiA01 79.40 Serine/threonine-protein kinase VRK3Homo sapiensProtein binding 3.30.200.20 110 8 67 2.51 3.73
3csvA01 78.86 Aminoglycoside phosphotransferaseRuegeria sp. TM1040 3.30.200.20 81 11 73 3.03 4.12
3dzoA02 77.31 Toxoplasma gondiiRop2 protein 3.30.200.20 118 9 66 3.10 4.69
2f2uB01 76.23 Chemokine signaling pathwayRho-associated, coiled-coil containing protein kinase [EC:2.7.11.1]Leukocyte transendothelial migrationWnt signaling pathwayTGF-beta signaling pathway 3.30.200.20 184 20 46 2.05 4.39
[1]
Displaying entries 1 to 80 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2a2aB01
EPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREEIEREVSILRQVLHHNVITLHD
VYENRTDVVLILELVS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2a2aB01
GMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREEIEREVSILRQVLHHNVITL
HDVYENRTDVVLILELVS
BLAST against CATH

[top]
Domain History Events (35)

Domain assigned by auto on 16 Mar 2009 15:12

Assigning to "3.30.200.20" based on similarity with "2a2aD01"

Flow stage update by auto on 16 Mar 2009 15:10

No in_process hits for Domain "2a2aB01" ready to be processed

Update comment by auto on 16 Mar 2009 15:07

Domain "2a2aB01" hits Domain "2a2aD01" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 15:05

Domain "2a2aB01" hits Domain "2a2aC01" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 15:02

Domain "2a2aB01" hits Domain "2a2aA01" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 15:00

Domain "2a2aB01" hits Domain "2a27H01" (100% over 88.7755102040816%) which is currently in process

Update comment by auto on 16 Mar 2009 14:57

Domain "2a2aB01" hits Domain "2a27F01" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 14:54

Domain "2a2aB01" hits Domain "2a27G01" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 14:51

Domain "2a2aB01" hits Domain "2a27E01" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 14:49

Domain "2a2aB01" hits Domain "2a27D01" (100% over 88.7755102040816%) which is currently in process

Update comment by auto on 16 Mar 2009 14:46

Domain "2a2aB01" hits Domain "2a27C01" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 14:44

Domain "2a2aB01" hits Domain "2a27B01" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 14:41

Domain "2a2aB01" hits Domain "2a27A01" (100% over 88.7755102040816%) which is currently in process

Update comment by auto on 16 Mar 2009 14:38

Domain "2a2aB01" hits Domain "1zwsE01" (98.9010989010989% over 91.8367346938775%) which is currently in process

Update comment by auto on 16 Mar 2009 14:36

Domain "2a2aB01" hits Domain "1zwsF01" (98.9010989010989% over 91.8367346938775%) which is currently in process

Update comment by auto on 16 Mar 2009 14:33

Domain "2a2aB01" hits Domain "1zwsH01" (98.9010989010989% over 91.8367346938775%) which is currently in process

Update comment by auto on 16 Mar 2009 14:29

Domain "2a2aB01" hits Domain "1zwsB01" (98.9010989010989% over 91.8367346938775%) which is currently in process

Update comment by auto on 16 Mar 2009 14:13

Domain "2a2aB01" hits Domain "1zwsC01" (98.9010989010989% over 91.8367346938775%) which is currently in process

Update comment by auto on 16 Mar 2009 14:02

Domain "2a2aB01" hits Domain "1zwsD01" (98.9010989010989% over 91.8367346938775%) which is currently in process

Update comment by auto on 16 Mar 2009 13:50

Domain "2a2aB01" hits Domain "1zwsG01" (98.9010989010989% over 91.8367346938775%) which is currently in process

Update comment by auto on 16 Mar 2009 13:34

Domain "2a2aB01" hits Domain "1zwsA01" (98.9010989010989% over 91.8367346938775%) which is currently in process

Update comment by auto on 16 Mar 2009 13:24

Domain "2a2aB01" hits Domain "1z9xC01" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 13:12

Domain "2a2aB01" hits Domain "1z9xB01" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 12:53

Domain "2a2aB01" hits Domain "1z9xA01" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 12:30

Domain "2a2aB01" hits Domain "1wmkG01" (100% over 88.7755102040816%) which is currently in process

Update comment by auto on 16 Mar 2009 12:09

Domain "2a2aB01" hits Domain "1wmkC01" (100% over 100%) which is currently in process

Update comment by auto on 16 Mar 2009 11:56

Domain "2a2aB01" hits Domain "1wmkH01" (100% over 88.7755102040816%) which is currently in process

Update comment by auto on 16 Mar 2009 11:43

Domain "2a2aB01" hits Domain "1wmkB01" (100% over 88.7755102040816%) which is currently in process

Update comment by auto on 16 Mar 2009 11:21

Domain "2a2aB01" hits Domain "1wmkD01" (100% over 88.7755102040816%) which is currently in process

Update comment by auto on 15 Mar 2009 23:42

Domain "2a2aB01" hits Domain "1wmkE01" (100% over 88.7755102040816%) which is currently in process

Flow stage update by auto on 15 Mar 2009 23:41

Domain "2a2aB01" hits Domain "1wmkE01" (100% over 88.7755102040816%) which is currently in process

Flow stage update by auto on 15 Mar 2009 23:41

NW result present for Domain "2a2aB01"

Flow stage update by auto on 15 Mar 2009 11:17

All required files are present for Domain "2a2aB01"

Flow stage update by auto on 15 Mar 2009 07:28

Beginning processing for Domain "2a2aB01"

Insertion by auto on 14 Mar 2009 23:00

Final ChopClose added based on similarity with "1z9xA"