Set cath from cathlist by auto on 05 Mar 2006 19:30
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1zymA01 | 3 | 20 |
| 1zymA01 | 147 | 249 |
| 1zymA02 | 21 | 146 |
There are 3 matching structural neighberhood comparisons for CATH ID 3.50.30.10.2.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2olsA03 | 81.42 | 3.50.30.10 | 87 | 27 | 70 | 3.21 | 4.57 | |
![]() |
2hi6A00 | 81.06 | 3.50.30.10 | 132 | 15 | 76 | 3.13 | 4.09 | |
![]() |
1zl0A02 | 76.54 | 3.50.30.60 | 138 | 11 | 71 | 3.36 | 4.68 |
>pdb|1zymA01 SGILASPGIAFGKALLLKIDLSAIQDEVILVAADLTPSETAQLNLKKVLGFITDAGGRTSHTSIMARSLELPAIVGTGSV TSQVKNDDYLILDAVNNQVYVNPTNEVIDKMRAVQEQVASE
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
This domain was assigned by cathlist2DB and was parsed from the cath list "/usr/local/cvs/source/lists/CathList"
PDB chopped based on information from the domall file "/usr/local/cvs/source/lists/CathDomall"