CATH Domain: 1zxmA01 XML data for domain: 1zxmA01

Molscript image for 1zxmA01
1zxmA01
PDB coordinates for domain 1zxmA01

PDB 1zxm, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.565 Heat Shock Protein 90
3.30.565.10 Gene3D
3.30.565.10.10
3.30.565.10.10.2
3.30.565.10.10.2.1
3.30.565.10.10.2.1.1
3.30.565.10.10.2.1.1.1

Segment boundaries for domain 1zxmA01

Chopping figure for domain 1zxmA01
DomainStart PDB ResidueStop PDB Residue
1zxmA01 38 276
1zxmA02 288 405

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.565.10.10.2.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1s14B00 81.80 CytoplasmPlasmid partitioningTopoisomerase IV subunit B [EC:5.99.1.-]DNA topoisomerase 4 subunit BSister chromatid cohesion 3.30.565.10 178 20 71 2.17 3.04
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|1zxmA01
TQLEHILLRPDTYIGSVELVTQQMWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLIS
IWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDN
MGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLK    

Domain COMBS Sequence

>pdb|1zxmA01
TQLEHILLRPDTYIGSVELVTQQMWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLIS
IWNNGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETASREYKKMFKQTWMDN
MGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMVRRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLK    

Domain History Events (6)

Domain assigned by auto on 22 Dec 2006 11:44

Assigning to "3.30.565.10" based on similarity with "1q1dA01"

Flow stage update by auto on 22 Dec 2006 11:40

No in_process hits for Domain "1zxmA01" ready to be processed

Flow stage update by auto on 22 Dec 2006 11:40

NW result present for Domain "1zxmA01"

Flow stage update by auto on 20 Dec 2006 19:31

All required files are present for Domain "1zxmA01"

Flow stage update by auto on 19 Dec 2006 19:40

Beginning processing for Domain "1zxmA01"

Insertion by auto on 19 Dec 2006 19:31

Final ChopClose added based on similarity with "1zxmB"