CATH Domain: 1zwvA00 XML data for domain: 1zwvA00

Molscript image for 1zwvA00
1zwvA00
PDB coordinates for domain 1zwvA00

PDB 1zwv, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.320 Dihydrolipoamide Transferase
4.10.320.10 Dihydrolipoamide Transferase Gene3D
4.10.320.10.4
4.10.320.10.4.1
4.10.320.10.4.1.1
4.10.320.10.4.1.1.1
4.10.320.10.4.1.1.1.1

[top]
Segment boundaries for domain 1zwvA00

Chopping figure for domain 1zwvA00
DomainStart PDB ResidueStop PDB Residue
1zwvA00 1 52

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 4.10.320.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1otrA00 75.38 Saccharomyces cerevisiaeProtein bindingUbiquitin-binding protein CUE2 1.10.8.10 49 4 73 3.39 4.64
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1zwvA00
GEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTLE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1zwvA00
GEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTLEHHHHHH
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 20 Jul 2007 19:38

Assigning to "4.10.320.10" based on similarity with "1w4eA00"

Flow stage update by auto on 20 Jul 2007 19:34

No in_process hits for Domain "1zwvA00" ready to be processed

Flow stage update by auto on 20 Jul 2007 19:34

NW result present for Domain "1zwvA00"

Flow stage update by auto on 16 Jul 2007 22:37

All required files are present for Domain "1zwvA00"

Flow stage update by auto on 14 Jul 2007 12:51

Beginning processing for Domain "1zwvA00"

Insertion by auto on 14 Jul 2007 10:22

Final ChopClose added based on similarity with "1w4eA"