CATH Domain: 1zvzA01 XML data for domain: 1zvzA01

Molscript image for 1zvzA01
1zvzA01
PDB coordinates for domain 1zvzA01

PDB 1zvz, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1490 vbs2 fragment of talin
1.20.1490.10 vbs2 fragment of talin Gene3D
1.20.1490.10.1
1.20.1490.10.1.1
1.20.1490.10.1.1.1
1.20.1490.10.1.1.1.1
1.20.1490.10.1.1.1.1.1

[top]
Segment boundaries for domain 1zvzA01

Chopping figure for domain 1zvzA01
DomainStart PDB ResidueStop PDB Residue
1zvzA01 0 128
1zvzA02 129 252

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 1.20.1490.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ra7A00 84.18 Focal adhesion kinase 1Integrin-mediated signaling pathwayCytoskeletonFocal adhesionHomo sapiens 1.20.120.330 128 13 89 4.35 4.88
1tr2A04 83.17 Cellular component movementCell adhesionNegative regulation of cell migrationApical junction assemblyAlpha-catenin binding 1.20.120.230 113 13 87 4.00 4.57
1lrzA03 75.36 Peptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan pentaglycine glycine transferase (the second and third glycine) [EC:2.3.2.-]Aminoacyltransferase femAStaphylococcus aureus 1.20.58.90 62 6 45 1.92 4.20
2ck3G01 74.09 Bos taurusATP synthase subunit gamma, mitochondrialProtein binding 1.10.287.80 61 1 42 1.94 4.55
3csxA00 73.26 Cyanothece sp. ATCC 51142DUF683-containing protein 1.10.287.660 61 3 45 2.08 4.55
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1zvzA01
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIK
VENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1zvzA01
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIK
VENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEA
BLAST against CATH

[top]
Domain History Events (7)

Classification merge by cuff on 16 Jun 2009 15:24

COMMENT: superfamily merge. same structure and function FINAL: merge 1.20.1490.20 -> 1.20.1490.10

Classification move by cuff on 27 Jun 2008 16:17

Moving Classification[<1.10.287.590> "Helix hairpin bin" [ACTIVE]] to Classification[<1.20.1490.20> "Vinculin head like domains"]:
name taken from information provided in pdb sum

Domain assigned by auto on 28 Apr 2006 21:22

Assigning to "1.10.287.590" based on similarity with "1u6hA01" (NWSI: 100, NWO: 100, SPS: 94.77, SPO: 100, RMSD: 1.11)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "1zvzA01"

Flow stage update by auto on 28 Apr 2006 17:48

All required files are present for Domain "1zvzA01"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "1zvzA01"

Insertion by auto on 10 Mar 2006 13:04

Final ChopClose added based on similarity with "1zw2A" [LEE: 2, LME: 0, MR: 0, LG: 2, SS: 93.76, SI: 100, SO: 100]