Domain assigned by auto on 10 Mar 2008 20:42
Assigning to "3.30.760.10" based on similarity with "2q4kB01"
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
>pdb|1ztpA01 DDPWLVFDARTTPATELDAWLAKYPPSQVTRYGDPGSPNSEPVGWIAVYGQGYSPNSGDVQGLQAAWEALQTSGRPITPG TLRQLAITHHVLSGKWLHLAPGFKLDHAWAGIARAVVEGRLQVAKVSPRAKEGGRQVICVYTDDFTDRLGVLEADSAIRA AGIKCLLTYKPDVYTYLGIYRANRWHLCPTLYESRFQGSRVLDRANNVEL
Assigning to "3.30.760.10" based on similarity with "2q4kB01"
No in_process hits for Domain "1ztpA01" ready to be processed
Domain "1ztpA01" hits Domain "2q4kB01" (99.0867579908676% over 100%) which is currently in process
Domain "1ztpA01" hits Domain "2q4kA01" (99.0867579908676% over 100%) which is currently in process
Domain "1ztpA01" hits Domain "2q4kA01" (99.0867579908676% over 100%) which is currently in process
NW result present for Domain "1ztpA01"
All required files are present for Domain "1ztpA01"
Beginning processing for Domain "1ztpA01"
fine