Domain assigned by cuff on 11 Feb 2008 12:09
def same superfamily
CATH Domain: 1zswA02
1zswA02
PDB 1zsw, Chain A, Domain 2
Segment boundaries for domain 1zswA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1zswA01 | -13 | 65 |
| 1zswA01 | 216 | 314 |
| 1zswA02 | 66 | 215 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|1zswA02 PLVGRTYRGTNAITRIGLLVPSEDSLHYWKERFEKFDVKHSEMTTYANRPALQFEDAEGLRLVLLVSNGEKVEHWETWEK SEVPAKHQIQGMGSVELTVRRLDKMASTLTEIFGYTEVSRNDQEAIFQSIKGEAFGEIVVKYLDGPTEKP
Domain History Events (40)
Homcheck comment by rupa on 10 Sep 2007 16:51
After second review, this still appears the best choice.
Domain assignment manual match h by rupa on 20 Aug 2007 15:19
Good cathedral and ssap scores and same pfam class.
Homcheck review by rupa on 20 Aug 2007 15:19
Good cathedral and ssap scores and same pfam class.
Flow stage update by rupa on 20 Aug 2007 15:19
Good cathedral and ssap scores and same pfam class.
Homcheck allotment by rupa on 20 Aug 2007 15:18
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by rupa on 20 Aug 2007 15:18
User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 25 May 2007 06:21
Domain "1zswA02" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 25 May 2007 06:17
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 1zswA02
Flow stage update by auto on 25 May 2007 06:14
Retrieved PRC_PFAMCATH results for job ID SID8633455309597808 and chopping inserted.
Domain scan prc pfamcath by auto on 25 May 2007 06:14
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 25 results for 1zswA02
Update comment by auto on 25 May 2007 02:24
PRC_PFAMCATH job SID8633455309597808 is not yet finished.
Flow stage update by auto on 25 May 2007 02:24
The entry "1zswA02" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 25 May 2007 02:24
The entry "1zswA02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 25 May 2007 02:16
Retrieved SSAP results for job ID SID3384598042717748 and chopping inserted.
Domain scan ssap cath by auto on 25 May 2007 02:15
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 510 results for 1zswA02
Update comment by auto on 24 May 2007 08:11
SSAP job SID3384598042717748 is not yet finished.
Ssap cath submit by auto on 24 May 2007 07:57
The entry "1zswA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 24 May 2007 07:57
The entry "1zswA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 24 May 2007 07:41
Retrieved PRC results for job ID SID9845276730559720 and inserted them into the database.
Domain scan prc cath by auto on 24 May 2007 07:41
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 14 results for 1zswA02
Prc cath submit by auto on 24 May 2007 07:11
The entry "1zswA02" has been submitted to the PRC webservice.
Flow stage update by auto on 24 May 2007 07:11
The entry "1zswA02" has been submitted to the PRC webservice.
Flow stage update by auto on 24 May 2007 06:55
Retrieved HMM(SAM) results for job ID SID4842331677767504 and inserted them into the database.
Domain scan sam cath by auto on 24 May 2007 06:55
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 1zswA02
Sam cath submit by auto on 24 May 2007 06:26
The entry "1zswA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 24 May 2007 06:26
The entry "1zswA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 24 May 2007 06:17
Retrieved "1zswA02" CATHEDRAL results for job ID SID5681827494893770 and inserted them into the database.
Domain scan cathedral cath by auto on 24 May 2007 06:16
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 650 results for 1zswA02
Update comment by auto on 24 May 2007 03:11
"1zswA02" CATHEDRAL job SID5681827494893770 is not yet finished.
Flow stage update by auto on 24 May 2007 02:38
The entry "1zswA02" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 24 May 2007 02:38
The entry "1zswA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 24 May 2007 02:24
ScanList with 8763 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1zswA02.scanlist" for "1zswA02"
Write scan list by auto on 24 May 2007 02:24
Writing ScanList containing 8763 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1zswA02.scanlist" for domain "1zswA02"
Flow stage update by auto on 24 May 2007 02:09
No satisfactory AssignClose result found.
Flow stage update by auto on 14 Mar 2007 15:14
No in_process hits for Domain "1zswA02" ready to be processed
Flow stage update by auto on 14 Mar 2007 15:06
NW result present for Domain "1zswA02"
Flow stage update by auto on 14 Mar 2007 15:04
All required files are present for Domain "1zswA02"
Flow stage update by auto on 14 Mar 2007 15:00
Beginning processing for Domain "1zswA02"
Insertion by cuff on 13 Dec 2006 16:19
nice batch of choppings
