CATH Domain: 1zoqA00 XML data for domain: 1zoqA00

Molscript image for 1zoqA00
1zoqA00
PDB coordinates for domain 1zoqA00

PDB 1zoq, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.200 Tumour Suppressor Smad4
2.60.200.10 Gene3D
2.60.200.10.4
2.60.200.10.4.1
2.60.200.10.4.1.1
2.60.200.10.4.1.1.1
2.60.200.10.4.1.1.1.1

Segment boundaries for domain 1zoqA00

Chopping figure for domain 1zoqA00
DomainStart PDB ResidueStop PDB Residue
1zoqA00 196 386

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 2.60.200.10.4.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1gxcA00 71.20 DNA damage response, signal transduction resulting in induction of apoptosisSenescenceSerine/threonine-protein kinase Chk2PML bodyProtein binding 2.60.200.20 116 7 57 2.77 4.81
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|1zoqA00
LVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALW
RAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQD
QPWTKRLVMVKVVPTCLRALVEMARVGGASS    

Domain COMBS Sequence

>pdb|1zoqA00
LVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALW
RAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQD
QPWTKRLVMVKVVPTCLRALVEMARVGGASS    

Domain History Events (11)

Domain assigned by auto on 01 Nov 2006 18:18

Assigning to "2.60.200.10" based on similarity with "1zoqB00"

Flow stage update by auto on 01 Nov 2006 18:04

No in_process hits for Domain "1zoqA00" ready to be processed

Update comment by auto on 01 Nov 2006 14:27

Domain "1zoqA00" hits Domain "1zoqB00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 09:48

Domain "1zoqA00" hits Domain "1zoqB00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 05:50

Domain "1zoqA00" hits Domain "1zoqB00" (100% over 100%) which is currently in process

Update comment by auto on 01 Nov 2006 02:09

Domain "1zoqA00" hits Domain "1zoqB00" (100% over 100%) which is currently in process

Flow stage update by auto on 01 Nov 2006 02:07

Domain "1zoqA00" hits Domain "1zoqB00" (100% over 100%) which is currently in process

Flow stage update by auto on 01 Nov 2006 02:07

NW result present for Domain "1zoqA00"

Flow stage update by auto on 01 Nov 2006 02:06

All required files are present for Domain "1zoqA00"

Flow stage update by auto on 31 Oct 2006 14:04

Beginning processing for Domain "1zoqA00"

Insertion by cuff on 31 Oct 2006 11:57

nice striaghtforward batch of choppings.