CATH Domain: 1zb9A01 XML data for domain: 1zb9A01

Molscript image for 1zb9A01
1zb9A01
PDB coordinates for domain 1zb9A01

PDB 1zb9, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.20 Single Sheet
2.20.25 N-terminal domain of TfIIb
2.20.25.10 Gene3D
2.20.25.10.3
2.20.25.10.3.1
2.20.25.10.3.1.1
2.20.25.10.3.1.1.1
2.20.25.10.3.1.1.1.1

[top]
Segment boundaries for domain 1zb9A01

Chopping figure for domain 1zb9A01
DomainStart PDB ResidueStop PDB Residue
1zb9A01 2 48
1zb9A02 49 143

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 2.20.25.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1vlaA01 76.69 Putative redox proteinThermotoga maritimaPutative uncharacterized protein 2.20.25.10 38 15 80 3.06 3.78
1ml8A01 76.35 Putative redox proteinEscherichia coli O157:H7Protein yhfA 2.20.25.10 34 5 68 3.27 4.80
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1zb9A01
NSLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1zb9A01
MNSLEKVLYTAIVTATGGRDGSVVSSDNVLNVKLSVPQGLGGPGGSGT
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 30 Nov 2006 13:30

Assigning to "2.20.25.10" based on similarity with "1zb8A01"

Flow stage update by auto on 30 Nov 2006 13:29

No in_process hits for Domain "1zb9A01" ready to be processed

Update comment by auto on 30 Nov 2006 09:22

Domain "1zb9A01" hits Domain "1zb9B01" (100% over 100%) which is currently in process

Flow stage update by auto on 30 Nov 2006 09:21

Domain "1zb9A01" hits Domain "1zb9B01" (100% over 100%) which is currently in process

Flow stage update by auto on 30 Nov 2006 09:21

NW result present for Domain "1zb9A01"

Flow stage update by auto on 29 Nov 2006 13:24

All required files are present for Domain "1zb9A01"

Flow stage update by auto on 28 Nov 2006 18:21

Beginning processing for Domain "1zb9A01"

Insertion by auto on 28 Nov 2006 17:47

Final ChopClose added based on similarity with "1zb8A"