CATH Domain: 1z7kB00 XML data for domain: 1z7kB00

Molscript image for 1z7kB00
1z7kB00
PDB coordinates for domain 1z7kB00

PDB 1z7k, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.60 Wheat Germ Agglutinin (Isolectin 2); domain 1
3.30.60.30 Gene3D
3.30.60.30.8
3.30.60.30.8.1
3.30.60.30.8.1.1
3.30.60.30.8.1.1.1
3.30.60.30.8.1.1.1.1

[top]
Segment boundaries for domain 1z7kB00

Chopping figure for domain 1z7kB00
DomainStart PDB ResidueStop PDB Residue
1z7kB00 2 63

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 3.30.60.30.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2arpF01 85.84 TGF-beta signaling pathwayFollistatinRattus norvegicusNegative regulation of follicle-stimulating hormone secretionHeparan sulfate proteoglycan binding 3.30.60.30 63 24 85 3.21 3.75
2b0uC03 82.67 Homo sapiensNegative regulation of transcription from RNA polymerase II promoterFollistatinPositive regulation of hair follicle developmentActivin binding 3.30.60.30 41 34 62 2.25 3.58
2jxdA00 79.96 Homo sapiensSerine protease inhibitor Kazal-type 2 3.30.60.30 62 33 85 3.05 3.57
1iw4A00 75.86 Halocynthia roretziTrypsin inhibitor 3.30.60.30 55 18 79 2.83 3.58
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1z7kB00
VPMDCSRYPNTTSEEGKVMILCNKALNPVCGTDGVTYDNECVLCAHNLEQGTSVGKKHDGEC
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1z7kB00
VPMDCSRYPNTTSEEGKVMILCNKALNPVCGTDGVTYDNECVLCAHNLEQGTSVGKKHDGEC
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 21:07

Assigning to "3.30.60.30" based on similarity with "1r0tB00" (NWSI: 100, NWO: 100, SPS: 99.57, SPO: 100, RMSD: 0.10)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "1z7kB00"

Flow stage update by auto on 28 Apr 2006 17:48

All required files are present for Domain "1z7kB00"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "1z7kB00"

Insertion by auto on 10 Mar 2006 06:56

Final ChopClose added based on similarity with "1r0tB" [LEE: 0, LME: 0, MR: 0, LG: 0, SS: 99.57, SI: 100, SO: 100]