Domain assigned by auto on 28 Apr 2006 21:07
Assigning to "1.20.1250.10" based on similarity with "1hwgA00" (NWSI: 85.3403141361257, NWO: 100, SPS: 87.34, SPO: 84, RMSD: 3.70)
There are 2 matching structural neighberhood comparisons for CATH ID 1.20.1250.10.14.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
3d48P00 | 85.38 | 1.20.1250.10 | 165 | 20 | 89 | 3.65 | 4.10 | |
![]() |
1wu3I00 | 79.86 | 1.20.1250.10 | 161 | 6 | 86 | 4.13 | 4.75 |
>pdb|1z7cA00 QTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLSFCFSDSIPTSNLELLRISLLLIESWLEPVRFLRSM FANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEQILKQTYSKFDTDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGS C
Assigning to "1.20.1250.10" based on similarity with "1hwgA00" (NWSI: 85.3403141361257, NWO: 100, SPS: 87.34, SPO: 84, RMSD: 3.70)
NW result present for Domain "1z7cA00"
All required files are present for Domain "1z7cA00"
Beginning processing for Domain "1z7cA00"