Domain assigned by auto on 12 Jul 2007 00:04
Assigning to "3.30.200.20" based on similarity with "1wbpA01"
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 1z57A01 | -2 | 220 |
| 1z57A01 | 225 | 243 |
| 1z57A02 | 221 | 224 |
| 1z57A02 | 244 | 482 |
There are 49 matching structural neighberhood comparisons for CATH ID 3.30.200.20.9.1.1.1.1 (SIMAX score < 5)
>pdb|1z57A01 SMHLICQSGDVLSARYEIVDTLGEGAFGKVVECIDHKAGGRHVAVKIVKNVDRYCEAARSEIQVLEHLNTTDPNSVQMLE WFEHHGHICIVFEL
Assigning to "3.30.200.20" based on similarity with "1wbpA01"
No in_process hits for Domain "1z57A01" ready to be processed
NW result present for Domain "1z57A01"
All required files are present for Domain "1z57A01"
Beginning processing for Domain "1z57A01"
nice chopping