CATH Domain: 1z2uA00 XML data for domain: 1z2uA00

Molscript image for 1z2uA00
1z2uA00
PDB coordinates for domain 1z2uA00

PDB 1z2u, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.110 Ubiquitin Conjugating Enzyme
3.10.110.10 Ubiquitin Conjugating Enzyme Gene3D
3.10.110.10.1
3.10.110.10.1.1
3.10.110.10.1.1.1
3.10.110.10.1.1.1.1
3.10.110.10.1.1.1.1.1

Segment boundaries for domain 1z2uA00

Chopping figure for domain 1z2uA00
DomainStart PDB ResidueStop PDB Residue
1z2uA00 -2 147

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 3.10.110.10.1.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2bepA00 92.27 Ubiquitin mediated proteolysisUbiquitin-conjugating enzyme E2 KBos taurusUbiquitin-conjugating enzyme (huntingtin interacting protein 2) [EC:6.3.2.19] 3.10.110.10 156 41 96 1.55 1.61
2e2cA00 90.72 Ubiquitin-conjugating enzyme E2 CSpisula solidissima 3.10.110.10 156 38 95 2.12 2.22
3h8kA00 90.31 Parkinson's diseaseUbiquitin mediated proteolysisUbiquitin-conjugating enzyme E2 G2 [EC:6.3.2.19]Homo sapiensProtein binding 3.10.110.10 164 36 90 1.29 1.43
2grrA00 90.20 Ubiquitin mediated proteolysisSUMO-conjugating enzyme UBC9Transcription factor bindingPML bodySynaptonemal complex 3.10.110.10 157 36 94 1.84 1.94
1zdnA00 90.03 Free ubiquitin chain polymerizationExit from mitosisActivation of anaphase-promoting complex activityUbiquitin-conjugating enzyme E2 SUbiquitin mediated proteolysis 3.10.110.10 151 36 98 1.89 1.92
1wzvA00 89.92 Parkinson's diseaseUbiquitin-conjugating enzyme E2 L6 [EC:6.3.2.19]Homo sapiensUbiquitin mediated proteolysisProtein binding 3.10.110.10 150 34 96 1.59 1.64
1br7003 89.06 3.10.110.10 117 43 78 1.02 1.31
2a4dA00 86.33 Protein polyubiquitinationUbiquitin-conjugating enzyme E2 variantNucleusUbiquitin-conjugating enzyme E2 variant 1Ubiquitin conjugating enzyme complex 3.10.110.10 139 23 85 2.72 3.19
1s1qA00 78.84 EndocytosisMultivesicular bodyPlasma membraneNucleolusTumor susceptibility gene 101 protein 3.10.110.10 137 13 76 3.43 4.47
3cegA00 75.37 Anti-apoptosisHomo sapiensBaculoviral IAP repeat-containing protein 6Protein binding 3.10.110.10 285 28 49 2.31 4.67
Displaying entries 1 to 10 (page 1 of 1)


Domain ATOM Sequence

>pdb|1z2uA00
GSHMALKRIQKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPN
INSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRERYNQLAREWTQKYAM    

Domain COMBS Sequence

>pdb|1z2uA00
GSHMALKRIQKELQDLGRDPPAQCSAGPVGDDLFHWQATIMGPPESPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPN
INSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRERYNQLAREWTQKYAM    

Domain History Events (10)

Domain assigned by auto on 02 Aug 2008 21:14

Assigning to "3.10.110.10" based on similarity with "1ur6A00"

Flow stage update by auto on 02 Aug 2008 21:11

No in_process hits for Domain "1z2uA00" ready to be processed

Update comment by auto on 02 Aug 2008 21:00

Domain "1z2uA00" hits Domain "1ylaA01" (42% over 94.3396226415094%) which is currently in process

Update comment by auto on 02 Aug 2008 20:46

Domain "1z2uA00" hits Domain "1w4uA00" (93.8775510204082% over 98%) which is currently in process

Update comment by auto on 02 Aug 2008 20:29

Domain "1z2uA00" hits Domain "1ylaB01" (42% over 94.3396226415094%) which is currently in process

Flow stage update by auto on 02 Aug 2008 20:16

Domain "1z2uA00" hits Domain "1ylaB01" (42% over 94.3396226415094%) which is currently in process

Flow stage update by auto on 02 Aug 2008 20:16

NW result present for Domain "1z2uA00"

Flow stage update by auto on 30 Jul 2008 08:28

All required files are present for Domain "1z2uA00"

Flow stage update by auto on 30 Jul 2008 02:04

Beginning processing for Domain "1z2uA00"

Insertion by auto on 29 Jul 2008 21:31

Final ChopClose added based on similarity with "1ur6A"