CATH Domain: 1z2lB01 XML data for domain: 1z2lB01

Molscript image for 1z2lB01
1z2lB01
PDB coordinates for domain 1z2lB01

PDB 1z2l, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.10 Zn peptidases Gene3D
3.40.630.10.16
3.40.630.10.16.1
3.40.630.10.16.1.1
3.40.630.10.16.1.1.1
3.40.630.10.16.1.1.1.1

[top]
Segment boundaries for domain 1z2lB01

Chopping figure for domain 1z2lB01
DomainStart PDB ResidueStop PDB Residue
1z2lB01 3 213
1z2lB01 329 412
1z2lB02 214 328

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.40.630.10.16.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3kasA01 79.96 Integral to plasma membraneHematopoietic cell lineageExtracellular regionCoated pitEndocytosis 3.40.630.10 308 9 76 2.87 3.73
2greA01 79.58 Aminopeptidase [EC:3.4.11.-]Deblocking aminopeptidaseBacillus cereus ATCC 14579 3.40.630.10 233 14 74 3.12 4.16
2cf4A01 78.90 Pyrococcus horikoshiiPutative uncharacterized protein PH0519 3.40.630.10 236 17 75 3.42 4.50
1cg2A01 78.66 Pseudomonas sp. RS-16Carboxypeptidase G2 3.40.630.10 279 13 80 3.49 4.36
2qyvA01 78.27 Arginine and proline metabolismGlutathione metabolismHistidine metabolismMetabolic pathwaysXaa-His dipeptidase. Metallo peptidase. MEROPS family M20C 3.40.630.10 250 12 76 3.40 4.44
1yloA01 77.66 Shigella flexneriPutative uncharacterized protein 3.40.630.10 254 15 75 3.04 4.00
2glfA01 76.74 Thermotoga maritimaProbable M18 family aminopeptidase 1 3.40.630.10 304 12 74 3.41 4.61
3ct9B01 76.70 Bacteroides thetaiotaomicronAcetylornithine deacetylase 3.40.630.10 233 14 72 3.14 4.31
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1z2lB01
LITHFRQAIEETLPWLSSFGADPAGGMTRLLYSPEWLETQQQFKKRMAASGLETRFDEVGNLYGRLNGTEYPQEVVLSGS
HIDTVVNGGNLDGQFGALAAWLAIDWLKTQYGAPLRTVEVVAMAEEEGSRFPYVFWGSKNIFGLANPDDVRNICDAKGNS
FVDAMKACGFTLPNAPLTPRQDIKAFVELHIEQGCVLESNGQSIGVVNAIVPVPMNKELVATLTELCEREKLNYRVMHSG
AGHDAQIFAPRVPTCMIFIPSINGISHNPAERTNITDLAEGVKTLALMLYQLAWQ
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1z2lB01
MSLITHFRQAIEETLPWLSSFGADPAGGMTRLLYSPEWLETQQQFKKRMAASGLETRFDEVGNLYGRLNGTEYPQEVVLS
GSHIDTVVNGGNLDGQFGALAAWLAIDWLKTQYGAPLRTVEVVAMAEEEGSRFPYVFWGSKNIFGLANPDDVRNICDAKG
NSFVDAMKACGFTLPNAPLTPRQDIKAFVELHIEQGCVLESNGQSIGVVNAIVPVPMNKELVATLTELCEREKLNYRVMH
SGAGHDAQIFAPRVPTCMIFIPSINGISHNPAERTNITDLAEGVKTLALMLYQLAWQKEGGSHHHHHH
BLAST against CATH

[top]
Domain History Events (81)

Domain assigned by cuff on 11 Feb 2008 12:13

great scores. same superfamily

Domain scan prc pfamcath by auto on 25 Sep 2007 10:54

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 62 results for 1z2lB01

Homcheck comment by rupa on 10 Sep 2007 16:45

After second review, this still appears the best choice.

Domain assignment manual match h by rupa on 20 Aug 2007 15:10

Good cathedral and ssap scores, high seq similarity, and same pfam class.

Homcheck review by rupa on 20 Aug 2007 15:10

Good cathedral and ssap scores, high seq similarity, and same pfam class.

Flow stage update by rupa on 20 Aug 2007 15:10

Good cathedral and ssap scores, high seq similarity, and same pfam class.

Homcheck allotment by rupa on 20 Aug 2007 15:09

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by rupa on 20 Aug 2007 15:09

User 'rupa' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 18 Jul 2007 19:42

Domain "1z2lB01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 18 Jul 2007 19:29

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 1z2lB01

Flow stage update by auto on 18 Jul 2007 19:29

Retrieved PRC_PFAMCATH results for job ID SID9493318348338286 and chopping inserted.

Update comment by auto on 18 Jul 2007 15:25

PRC_PFAMCATH job SID9493318348338286 is not yet finished.

Flow stage update by auto on 18 Jul 2007 15:25

The entry "1z2lB01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 18 Jul 2007 15:24

The entry "1z2lB01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 18 Jul 2007 15:23

Retrieved SSAP results for job ID SID6085645344459342 and chopping inserted.

Domain scan ssap cath by auto on 18 Jul 2007 15:22

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 100 results for 1z2lB01

Update comment by auto on 16 Jul 2007 19:47

SSAP job SID6085645344459342 is not yet finished.

Ssap cath submit by auto on 16 Jul 2007 19:39

The entry "1z2lB01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Jul 2007 19:39

The entry "1z2lB01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Jul 2007 15:55

Giving up on SSAP job SID7357554476676112 because submission time of Sat Jul 14 13:10:03 2007 is more than 172800 seconds older than current time (Mon Jul 16 15:55:31 2007).

Update comment by auto on 14 Jul 2007 13:31

SSAP job SID7357554476676112 is not yet finished.

Ssap cath submit by auto on 14 Jul 2007 13:10

The entry "1z2lB01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Jul 2007 13:10

The entry "1z2lB01" has been submitted to the SSAP webservice.

Flow stage update by auto on 14 Jul 2007 06:18

Giving up on SSAP job SID2552849238759760 because submission time of Wed Jul 11 22:11:13 2007 is more than 172800 seconds older than current time (Sat Jul 14 06:18:41 2007).

Update comment by auto on 11 Jul 2007 22:36

SSAP job SID2552849238759760 is not yet finished.

Flow stage update by auto on 11 Jul 2007 22:11

The entry "1z2lB01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 11 Jul 2007 22:11

The entry "1z2lB01" has been submitted to the SSAP webservice.

Flow stage update by auto on 11 Jul 2007 20:35

Giving up on SSAP job SID5656325159905120 because submission time of Mon Jul 9 19:34:48 2007 is more than 172800 seconds older than current time (Wed Jul 11 20:35:10 2007).

Update comment by auto on 09 Jul 2007 20:15

SSAP job SID5656325159905120 is not yet finished.

Ssap cath submit by auto on 09 Jul 2007 19:34

The entry "1z2lB01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Jul 2007 19:34

The entry "1z2lB01" has been submitted to the SSAP webservice.

Flow stage update by auto on 09 Jul 2007 15:25

Giving up on SSAP job SID1449963258526164 because submission time of Sat Jul 7 14:27:00 2007 is more than 172800 seconds older than current time (Mon Jul 9 15:25:21 2007).

Update comment by auto on 07 Jul 2007 15:06

SSAP job SID1449963258526164 is not yet finished.

Ssap cath submit by auto on 07 Jul 2007 14:27

The entry "1z2lB01" has been submitted to the SSAP webservice.

Flow stage update by auto on 07 Jul 2007 14:27

The entry "1z2lB01" has been submitted to the SSAP webservice.

Flow stage update by auto on 07 Jul 2007 12:35

Giving up on SSAP job SID3545748380027840 because submission time of Thu Jul 5 11:15:35 2007 is more than 172800 seconds older than current time (Sat Jul 7 12:35:58 2007).

Update comment by auto on 05 Jul 2007 12:18

SSAP job SID3545748380027840 is not yet finished.

Ssap cath submit by auto on 05 Jul 2007 11:15

The entry "1z2lB01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Jul 2007 11:15

The entry "1z2lB01" has been submitted to the SSAP webservice.

Flow stage update by auto on 05 Jul 2007 09:01

Retrieved PRC results for job ID SID8289598789678112 and inserted them into the database.

Domain scan prc cath by auto on 05 Jul 2007 09:00

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 14 results for 1z2lB01

Update comment by auto on 04 Jul 2007 07:52

PRC job SID8289598789678112 is not yet finished.

Flow stage update by auto on 04 Jul 2007 07:18

The entry "1z2lB01" has been submitted to the PRC webservice.

Prc cath submit by auto on 04 Jul 2007 07:18

The entry "1z2lB01" has been submitted to the PRC webservice.

Flow stage update by auto on 04 Jul 2007 06:29

Retrieved HMM(SAM) results for job ID SID8607402324830416 and inserted them into the database.

Domain scan sam cath by auto on 04 Jul 2007 06:29

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 13 results for 1z2lB01

Update comment by auto on 04 Jul 2007 00:24

HMM(SAM) job SID8607402324830416 is not yet finished.

Sam cath submit by auto on 03 Jul 2007 22:44

The entry "1z2lB01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Jul 2007 22:44

The entry "1z2lB01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Jul 2007 19:02

Retrieved "1z2lB01" CATHEDRAL results for job ID SID2376113952180410 and inserted them into the database.

Domain scan cathedral cath by auto on 03 Jul 2007 19:01

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 492 results for 1z2lB01

Update comment by auto on 03 Jul 2007 09:05

"1z2lB01" CATHEDRAL job SID2376113952180410 is not yet finished.

Flow stage update by auto on 03 Jul 2007 07:47

The entry "1z2lB01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 03 Jul 2007 07:47

The entry "1z2lB01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 03 Jul 2007 06:41

ScanList with 8825 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/1z2lB01.scanlist" for "1z2lB01"

Write scan list by auto on 03 Jul 2007 06:41

Writing ScanList containing 8825 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/1z2lB01.scanlist" for domain "1z2lB01"

Update comment by auto on 03 Jul 2007 02:13

Waiting for 19 new domains (example : 2obkD00) to be processed so that they can be scanned against too.

Update comment by auto on 02 Jul 2007 22:05

Waiting for 75 new domains (example : 2hh9B02) to be processed so that they can be scanned against too.

Update comment by auto on 02 Jul 2007 18:22

Waiting for 150 new domains (example : 2a7wF00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 10:02

Waiting for 155 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 06:05

Waiting for 154 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 30 Jun 2007 02:05

Waiting for 153 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 22:01

Waiting for 151 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 18:09

Waiting for 149 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 14:07

Waiting for 147 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 10:03

Waiting for 145 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 06:03

Waiting for 142 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 29 Jun 2007 02:07

Waiting for 139 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 22:02

Waiting for 136 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 18:10

Waiting for 133 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 14:06

Waiting for 130 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 10:04

Waiting for 126 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 06:07

Waiting for 120 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 28 Jun 2007 02:09

Waiting for 114 new domains (example : 2a7wA00) to be processed so that they can be scanned against too.

Update comment by auto on 27 Jun 2007 22:29

Waiting for 100 new domains (example : 2a7wC00) to be processed so that they can be scanned against too.

Flow stage update by auto on 27 Jun 2007 22:13

No satisfactory AssignClose result found.

Flow stage update by auto on 25 Jun 2007 18:02

No in_process hits for Domain "1z2lB01" ready to be processed

Flow stage update by auto on 25 Jun 2007 18:02

NW result present for Domain "1z2lB01"

Flow stage update by auto on 25 Jun 2007 18:02

All required files are present for Domain "1z2lB01"

Flow stage update by auto on 25 Jun 2007 18:02

Beginning processing for Domain "1z2lB01"

Insertion by cuff on 30 May 2007 14:43

validated chopping