CATH Domain: 1z2lA02 XML data for domain: 1z2lA02

Molscript image for 1z2lA02
1z2lA02
PDB coordinates for domain 1z2lA02

PDB 1z2l, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.70 Alpha-Beta Plaits
3.30.70.360 Gene3D
3.30.70.360.6
3.30.70.360.6.1
3.30.70.360.6.1.1
3.30.70.360.6.1.1.1
3.30.70.360.6.1.1.1.1

Segment boundaries for domain 1z2lA02

Chopping figure for domain 1z2lA02
DomainStart PDB ResidueStop PDB Residue
1z2lA01 3 213
1z2lA01 329 413
1z2lA02 214 328

Structural Neighbourhood (20 entries)

There are 20 matching structural neighberhood comparisons for CATH ID 3.30.70.360.6.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 20 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1cg2A02 87.80 Pseudomonas sp. RS-16Carboxypeptidase G2 3.30.70.360 110 13 94 2.36 2.49
1xmbA02 85.92 Auxin metabolic processArabidopsis thalianaIAA-Ala conjugate hydrolase activityIAA-amino acid hydrolase ILR1-like 2 3.30.70.360 101 16 79 1.88 2.38
3ct9A02 83.16 Bacteroides thetaiotaomicronAcetylornithine deacetylase 3.30.70.360 104 18 86 2.76 3.21
1j27A00 81.43 Hypothetical proteinThermus thermophilusPutative uncharacterized protein 3.30.70.1120 98 7 80 2.89 3.61
1q8kA03 80.51 Translation initiation factor activityTranslation initiation factor eIF-2 alpha subunitEukaryotic translation initiation factor 2 subunit 1PolysomeHomo sapiens 3.30.70.1130 116 3 77 2.71 3.49
2ia0B02 78.95 Pyrococcus furiosusUncharacterized HTH-type transcriptional regulator PF0864 3.30.70.920 99 8 66 2.26 3.42
3bm7A00 78.33 Caulobacter vibrioidesPutative uncharacterized protein 3.30.70.900 101 9 76 3.47 4.53
2pd1A01 78.07 Nitrosomonas europaeaPutative uncharacterized protein 3.30.70.900 93 9 75 2.69 3.56
2nzcA00 77.91 Thermotoga maritimaPutative uncharacterized protein 3.30.70.1150 77 9 66 2.72 4.12
1x7vC00 77.47 Pseudomonas aeruginosaPutative uncharacterized protein 3.30.70.900 97 8 77 3.77 4.87
1in0A01 76.84 Hypothetical proteinHaemophilus influenzaeUPF0234 protein HI_1034 3.30.70.860 70 8 60 2.57 4.22
2pokA02 76.40 Lysine biosynthesisMetabolic pathwaysSuccinyl-diaminopimelate desuccinylase [EC:3.5.1.18]Peptidase, M20/M25/M40 familyStreptococcus pneumoniae 3.30.70.360 170 7 64 3.10 4.79
1u7lA01 76.28 V-type H+-transporting ATPase subunit C [EC:3.6.3.14]Oxidative phosphorylationVacuolar acidificationProtein bindingVacuolar proton-transporting V-type ATPase, V1 domain 3.30.70.1180 91 5 63 2.98 4.69
1vr6A01 76.19 Phenylalanine, tyrosine and tryptophan biosynthesisMetabolic pathwaysThermotoga maritima3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]Phospho-2-dehydro-3-deoxyheptonate aldolase 3.30.70.1140 75 9 63 3.07 4.84
2bbeA00 76.00 Shewanella oneidensisPutative uncharacterized protein 3.30.70.900 92 6 72 3.60 4.99
2iboA00 75.73 Streptococcus pneumoniaePutative uncharacterized protein 3.30.70.930 87 3 62 2.83 4.52
1lfwA03 75.73 Lactobacillus delbrueckii subsp. lactisBeta-Ala-Xaa dipeptidase 3.30.70.360 88 6 55 2.16 3.88
1s99A01 75.60 Bacillus subtilisPutative HMP/thiamine-binding protein ykoF 3.30.70.930 77 7 62 3.06 4.89
1qapA01 74.97 Nicotinate and nicotinamide metabolismMetabolic pathwaysNicotinate-nucleotide pyrophosphorylase (carboxylating) [EC:2.4.2.19]Salmonella enterica subsp. enterica serovar TyphimuriumNicotinate-nucleotide pyrophosphorylase [carboxylating] 3.90.1170.20 122 6 63 3.04 4.75
2fgcA03 73.98 Butanoate metabolismC5-Branched dibasic acid metabolismPantothenate and CoA biosynthesisValine, leucine and isoleucine biosynthesisMetabolic pathways 3.30.70.1150 74 6 56 2.75 4.87
Displaying entries 1 to 20 (page 1 of 1)


Domain ATOM Sequence

>pdb|1z2lA02
GQRRYTVTLNGESNHAGTTPMGYRRDTVYAFSRICHQSVEKAKRMGDPLVLTFGKVEPRPNTVNVVPGKTTFTIDCRHTD
AAVLRDFTQQLENDMRAICDEMDIGIDIDLWMDEE    

Domain COMBS Sequence

>pdb|1z2lA02
GQRRYTVTLNGESNHAGTTPMGYRRDTVYAFSRICHQSVEKAKRMGDPLVLTFGKVEPRPNTVNVVPGKTTFTIDCRHTD
AAVLRDFTQQLENDMRAICDEMDIGIDIDLWMDEE    

Domain History Events (12)

Domain assigned by auto on 11 Feb 2008 14:13

Assigning to "3.30.70.360" based on similarity with "1z2lB02"

Flow stage update by auto on 11 Feb 2008 14:04

No in_process hits for Domain "1z2lA02" ready to be processed

Update comment by auto on 03 Sep 2007 20:09

Domain "1z2lA02" hits Domain "1z2lB02" (100% over 100%) which is currently in process

Update comment by auto on 03 Sep 2007 11:15

Domain "1z2lA02" hits Domain "1z2lB02" (100% over 100%) which is currently in process

Update comment by auto on 11 Aug 2007 14:38

Domain "1z2lA02" hits Domain "1z2lB02" (100% over 100%) which is currently in process

Update comment by auto on 10 Aug 2007 23:21

Domain "1z2lA02" hits Domain "1z2lB02" (100% over 100%) which is currently in process

Update comment by auto on 27 Jun 2007 22:02

Domain "1z2lA02" hits Domain "1z2lB02" (100% over 100%) which is currently in process

Flow stage update by auto on 25 Jun 2007 18:02

Domain "1z2lA02" hits Domain "1z2lB02" (100% over 100%) which is currently in process

Flow stage update by auto on 25 Jun 2007 18:02

NW result present for Domain "1z2lA02"

Flow stage update by auto on 25 Jun 2007 18:02

All required files are present for Domain "1z2lA02"

Flow stage update by auto on 25 Jun 2007 18:02

Beginning processing for Domain "1z2lA02"

Insertion by auto on 30 May 2007 18:03

Final ChopClose added based on similarity with "1z2lB"