CATH Domain: 1z1vA00 XML data for domain: 1z1vA00

Molscript image for 1z1vA00
1z1vA00
PDB coordinates for domain 1z1vA00

PDB 1z1v, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.150 DNA polymerase; domain 1
1.10.150.50 Transcription Factor, Ets-1 Gene3D
1.10.150.50.10
1.10.150.50.10.1
1.10.150.50.10.1.1
1.10.150.50.10.1.1.1
1.10.150.50.10.1.1.1.1

[top]
Segment boundaries for domain 1z1vA00

Chopping figure for domain 1z1vA00
DomainStart PDB ResidueStop PDB Residue
1z1vA00 33 102

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.10.150.50.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1x9xA00 85.19 MAPK signaling pathway - yeastSAM domain bindingIdentical protein bindingInvasive growth in response to glucose limitationActivation of MAPKK activity 1.10.150.50 62 6 87 2.28 2.62
1v38A00 83.75 Mus musculusSAM domain-containing protein SAMSN-1 1.10.150.50 78 8 84 3.33 3.94
2o6kB00 76.61 UPF0346 protein in crr 3'regionStaphylococcus aureus 1.10.150.260 72 1 90 4.42 4.90
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|1z1vA00
SQWSVDDVITWCISTLEVEETDPLCQRLRENDIVGDLLPELCLQDCQDLCDGDLNKAIKFKILINKMRDS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|1z1vA00
GSHMFSQWSVDDVITWCISTLEVEETDPLCQRLRENDIVGDLLPELCLQDCQDLCDGDLNKAIKFKILINKMRDSKLEWK
BLAST against CATH

[top]
Domain History Events (5)

Domain assigned by auto on 28 Apr 2006 21:04

Assigning to "1.10.150.50" based on similarity with "1uqvA00" (NWSI: 100, NWO: 94.1176470588235, SPS: 85.87, SPO: 82, RMSD: 1.82)

Flow stage update by auto on 28 Apr 2006 17:51

NW result present for Domain "1z1vA00"

Flow stage update by auto on 28 Apr 2006 17:48

All required files are present for Domain "1z1vA00"

Flow stage update by auto on 27 Apr 2006 17:32

Beginning processing for Domain "1z1vA00"

Insertion by auto on 17 Mar 2006 18:40

Final ChopClose added based on similarity with "1uqvA" [LEE: 0, LME: 0, MR: 9, LG: 9, SS: 85.87, SI: 100, SO: 94.1176470588235]